Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1292
Gene name
Locationscaffold_142:148..695
Strand+
Gene length (bp)547
Transcript length (bp)339
Coding sequence length (bp)336
Protein length (aa) 112

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10247 Romo1 Reactive mitochondrial oxygen species modulator 1 1.0E-27 16 81

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02889|MGR2_YEAST Protein MGR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGR2 PE=1 SV=1 1 98 7.0E-23
sp|P79082|MGR2_SCHPO Protein mgr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mgr2 PE=2 SV=1 15 85 1.0E-18
sp|Q6NYD1|ROMO1_DANRE Reactive oxygen species modulator 1 OS=Danio rerio GN=romo1 PE=3 SV=1 3 81 9.0E-10
sp|A4QNF3|ROMO1_XENTR Reactive oxygen species modulator 1 OS=Xenopus tropicalis GN=romo1 PE=3 SV=1 11 81 3.0E-09
sp|Q4V7T9|ROMO1_XENLA Reactive oxygen species modulator 1 OS=Xenopus laevis GN=romo1 PE=3 SV=1 11 81 8.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02889|MGR2_YEAST Protein MGR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGR2 PE=1 SV=1 1 98 7.0E-23
sp|P79082|MGR2_SCHPO Protein mgr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mgr2 PE=2 SV=1 15 85 1.0E-18
sp|Q6NYD1|ROMO1_DANRE Reactive oxygen species modulator 1 OS=Danio rerio GN=romo1 PE=3 SV=1 3 81 9.0E-10
sp|A4QNF3|ROMO1_XENTR Reactive oxygen species modulator 1 OS=Xenopus tropicalis GN=romo1 PE=3 SV=1 11 81 3.0E-09
sp|Q4V7T9|ROMO1_XENLA Reactive oxygen species modulator 1 OS=Xenopus laevis GN=romo1 PE=3 SV=1 11 81 8.0E-09
sp|P60603|ROMO1_MOUSE Reactive oxygen species modulator 1 OS=Mus musculus GN=Romo1 PE=2 SV=1 11 81 2.0E-08
sp|P60602|ROMO1_HUMAN Reactive oxygen species modulator 1 OS=Homo sapiens GN=ROMO1 PE=1 SV=1 11 81 2.0E-08
sp|Q3SZV8|ROMO1_BOVIN Reactive oxygen species modulator 1 OS=Bos taurus GN=ROMO1 PE=3 SV=1 11 81 2.0E-08
sp|A1XQR6|ROMO1_PIG Reactive oxygen species modulator 1 OS=Sus scrofa GN=ROMO1 PE=3 SV=1 11 81 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.5

Transmembrane Domains

Domain # Start End Length
1 23 45 22
2 57 79 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 178.28 85.32 271.24
CcL In ants, during behavior modification 126.54 54.58 198.50
CcD In ants, recently dead 214.61 106.52 322.71

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.224160 no
SC16a CcD 0.514947 no
CcL CcD 0.046309 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1292
MPPVPAASTGGHHGPSNLDKLKMGAMMGGTVGVIIGFIFGSVNIFRYGAGSQGVMRTLGQYMGASGATFGFFMSI
GSVIRSDADPEKLHELYMRAQHRRPIAVLADSGWRRS
Coding >Ophio5|1292
ATGCCTCCTGTACCGGCTGCCTCCACCGGCGGCCATCACGGCCCTTCCAATCTGGACAAGCTCAAGATGGGCGCC
ATGATGGGCGGAACCGTCGGCGTCATCATTGGCTTTATTTTTGGGAGCGTCAACATCTTCCGATACGGCGCAGGC
TCTCAGGGCGTCATGAGAACACTCGGCCAATACATGGGTGCTTCGGGAGCTACATTCGGCTTCTTTATGTCCATT
GGCAGCGTCATCCGGTCTGACGCCGATCCCGAAAAATTGCACGAGTTGTACATGCGAGCACAACACCGGCGGCCC
ATTGCCGTGCTGGCAGACTCTGGCTGGCGAAGAAGT
Transcript >Ophio5|1292
ATGCCTCCTGTACCGGCTGCCTCCACCGGCGGCCATCACGGCCCTTCCAATCTGGACAAGCTCAAGATGGGCGCC
ATGATGGGCGGAACCGTCGGCGTCATCATTGGCTTTATTTTTGGGAGCGTCAACATCTTCCGATACGGCGCAGGC
TCTCAGGGCGTCATGAGAACACTCGGCCAATACATGGGTGCTTCGGGAGCTACATTCGGCTTCTTTATGTCCATT
GGCAGCGTCATCCGGTCTGACGCCGATCCCGAAAAATTGCACGAGTTGTACATGCGAGCACAACACCGGCGGCCC
ATTGCCGTGCTGGCAGACTCTGGCTGGCGAAGAAGTTGA
Gene >Ophio5|1292
ATGCCTCCTGTACCGGCTGCCTCCACCGGCGGCCATCACGGCCCTTCCAATCTGGACAAGCGTACGTCTGCGCTC
GCCGCCGGCGCCGTATCGCGACACTGACACCAGACCGCAGTCAAGATGGGCGCCATGATGGGCGGAAGTATGCCT
CCATCGAAGCCGTCTCCTCTGTCGAGCACACTACTGACGCCTCGCCAGCCGTCGGCGTCATCATTGGCTTTATTT
TTGGTACCGCGATCACGGCTGACCACAATGGTCCACGCTGACCTGTCGTAGGGAGCGTCAACATCTTCCGATACG
GCGCAGGCTCTCAGGGCGTCATGAGAACACTCGGCCAATACATGGGTGCTTCGGGAGCTACATTCGGGTCCGTCG
CTACTCGAAATTGTCCTTTTCTCCACTGCTGATTGCGCCCAGCTTCTTTATGTCCATTGGCAGCGTCATCCGGTC
TGACGCCGATCCCGAAAAATTGCACGAGTTGTACATGCGAGCACAACACCGGCGGCCCATTGCCGTGCTGGCAGA
CTCTGGCTGGCGAAGAAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail