Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1277
Gene name
Locationscaffold_141:22170..22672
Strand+
Gene length (bp)502
Transcript length (bp)360
Coding sequence length (bp)357
Protein length (aa) 119

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06766 Hydrophobin_2 Fungal hydrophobin 3.6E-29 54 118

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 1 117 2.0E-22
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 51 115 1.0E-21
sp|P52753|CRYP_CRYPA Cryparin OS=Cryphonectria parasitica GN=CRP PE=1 SV=1 1 118 1.0E-21
sp|P52755|QID3_TRIHA Cell wall protein qid3 OS=Trichoderma harzianum GN=qid3 PE=2 SV=1 54 119 6.0E-20
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 58 116 3.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 1 117 2.0E-22
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 51 115 1.0E-21
sp|P52753|CRYP_CRYPA Cryparin OS=Cryphonectria parasitica GN=CRP PE=1 SV=1 1 118 1.0E-21
sp|P52755|QID3_TRIHA Cell wall protein qid3 OS=Trichoderma harzianum GN=qid3 PE=2 SV=1 54 119 6.0E-20
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 58 116 3.0E-16
sp|P52754|HYP1_HYPJE Hydrophobin-1 OS=Hypocrea jecorina GN=hfb1 PE=1 SV=1 47 116 4.0E-16
sp|Q06153|CEUL_OPHUL Cerato-ulmin OS=Ophiostoma ulmi GN=CU PE=1 SV=1 54 119 7.0E-12
sp|P79073|HYP2_HYPJE Hydrophobin-2 OS=Hypocrea jecorina GN=hfb2 PE=1 SV=1 54 117 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1277
MKFLALAMIFVGALATPTDYHHGGGGDKGDNNGGGGGGGGGGGGGGGGGAGFSCTPGLYSNAQCCATDVLGVADL
DCRAPWKSPRNVGDFKTICARDGQRARCCVLPVLGQGVLCKEPA
Coding >Ophio5|1277
ATGAAGTTTCTGGCCCTTGCCATGATTTTCGTGGGCGCTCTCGCCACGCCCACTGACTATCATCACGGCGGCGGC
GGCGACAAAGGCGACAACAACGGCGGTGGCGGCGGCGGCGGTGGTGGTGGCGGTGGTGGTGGTGGAGGAGGTGCC
GGCTTCTCCTGCACTCCCGGCCTCTACAGCAACGCCCAGTGCTGTGCCACTGATGTCCTCGGGGTCGCCGACCTC
GACTGCAGGGCGCCCTGGAAGTCCCCTCGTAACGTGGGAGACTTCAAGACCATCTGCGCCAGAGACGGCCAGCGC
GCTCGCTGCTGTGTTCTCCCGGTTCTTGGCCAGGGTGTCCTCTGCAAAGAACCCGCC
Transcript >Ophio5|1277
ATGAAGTTTCTGGCCCTTGCCATGATTTTCGTGGGCGCTCTCGCCACGCCCACTGACTATCATCACGGCGGCGGC
GGCGACAAAGGCGACAACAACGGCGGTGGCGGCGGCGGCGGTGGTGGTGGCGGTGGTGGTGGTGGAGGAGGTGCC
GGCTTCTCCTGCACTCCCGGCCTCTACAGCAACGCCCAGTGCTGTGCCACTGATGTCCTCGGGGTCGCCGACCTC
GACTGCAGGGCGCCCTGGAAGTCCCCTCGTAACGTGGGAGACTTCAAGACCATCTGCGCCAGAGACGGCCAGCGC
GCTCGCTGCTGTGTTCTCCCGGTTCTTGGCCAGGGTGTCCTCTGCAAAGAACCCGCCTAA
Gene >Ophio5|1277
ATGAAGTTTCTGGCCCTTGCCATGATTTTCGTGGGCGCTCTCGCCACGCCCACTGACTATCATCACGGCGGCGGC
GGCGACAAAGGCGACAACAACGGCGGTGGCGGCGGCGGCGGTGGTGGTGGCGGTGGTGGTGGTGGAGGAGGTGCC
GGCTTCTCCTGCACTCCCGGCCTCTACAGCAACGCCCAGTGCTGTGCCACTGATGTCCTCGGGGTCGCCGACCTC
GACTGCAGGGCGCGTGAGTCTTCCGAAGCCAGCCTCTGGCGTCTCCCCAATGGTTATACTCACACTCCATCGTCC
CCCTAGCCTGGAAGTCCCCTCGTAACGTGGGAGACTTCAAGACCATCTGCGCCAGAGACGGCCAGCGCGCTCGCT
GCTGTGTTCTCCCGGTTGTCAGTCACCCTCATTTTCCCCTTCGAAGCGAAGAAAGAAAAGAAAACTGACGCAGCT
TGTTTTTCCCACACAGCTTGGCCAGGGTGTCCTCTGCAAAGAACCCGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail