© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophio5|1272 |
| Gene name | |
| Location | scaffold_141:10252..11862 |
| Strand | - |
| Gene length (bp) | 1610 |
| Transcript length (bp) | 1542 |
| Coding sequence length (bp) | 1539 |
| Protein length (aa) | 513 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00067 | p450 | Cytochrome P450 | 8.2E-86 | 49 | 507 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P17549|CP53_ASPNG | Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 | 31 | 513 | 0.0E+00 |
| sp|Q12608|STCB_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 | 24 | 479 | 1.0E-41 |
| sp|P38364|PID6_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 | 13 | 470 | 3.0E-41 |
| sp|Q12645|PID9_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 | 13 | 470 | 1.0E-40 |
| sp|A1DA60|FTMC_NEOFI | Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 | 32 | 512 | 2.0E-39 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P17549|CP53_ASPNG | Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 | 31 | 513 | 0.0E+00 |
| sp|Q12608|STCB_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 | 24 | 479 | 1.0E-41 |
| sp|P38364|PID6_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 | 13 | 470 | 3.0E-41 |
| sp|Q12645|PID9_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 | 13 | 470 | 1.0E-40 |
| sp|A1DA60|FTMC_NEOFI | Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 | 32 | 512 | 2.0E-39 |
| sp|O13317|TRI11_FUSSP | Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 | 25 | 475 | 8.0E-38 |
| sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 32 | 475 | 7.0E-37 |
| sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 32 | 475 | 7.0E-37 |
| sp|Q12609|STCF_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 | 24 | 473 | 5.0E-36 |
| sp|O00061|CP67_UROFA | Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 | 25 | 485 | 2.0E-35 |
| sp|Q64459|CP3AB_MOUSE | Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 | 124 | 485 | 1.0E-31 |
| sp|Q12732|AVNA_ASPPA | Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 | 61 | 473 | 6.0E-31 |
| sp|Q9JMA7|CP341_MOUSE | Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 | 271 | 485 | 4.0E-30 |
| sp|Q64409|CP3AH_CAVPO | Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 | 157 | 483 | 3.0E-29 |
| sp|P05183|CP3A2_RAT | Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 | 123 | 485 | 3.0E-29 |
| sp|Q27519|C13A7_CAEEL | Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 | 283 | 484 | 5.0E-29 |
| sp|Q64481|CP3AG_MOUSE | Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 | 124 | 485 | 2.0E-28 |
| sp|P04800|CP3A1_RAT | Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 | 271 | 485 | 4.0E-28 |
| sp|P51538|CP3A9_RAT | Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 | 123 | 500 | 6.0E-28 |
| sp|O70537|CP3AV_MESAU | Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 | 255 | 485 | 7.0E-28 |
| sp|Q64406|CP3AF_CAVPO | Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 | 157 | 485 | 1.0E-27 |
| sp|P24463|CP3AC_CANLF | Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 | 270 | 485 | 1.0E-27 |
| sp|Q27515|C13A6_CAEEL | Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 | 283 | 512 | 1.0E-27 |
| sp|Q64417|CP3AE_CAVPO | Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 | 157 | 485 | 1.0E-27 |
| sp|Q9VB31|C6A18_DROME | Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 | 285 | 488 | 3.0E-27 |
| sp|Q27513|C13A4_CAEEL | Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 | 123 | 483 | 6.0E-27 |
| sp|Q29496|CP3AO_SHEEP | Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 | 270 | 485 | 6.0E-27 |
| sp|Q27520|C13A1_CAEEL | Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 | 283 | 484 | 1.0E-26 |
| sp|P14779|CPXB_BACME | Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 | 256 | 509 | 2.0E-26 |
| sp|P11707|CP3A6_RABIT | Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 | 123 | 484 | 2.0E-26 |
| sp|Q27514|C13A5_CAEEL | Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 | 304 | 484 | 2.0E-26 |
| sp|Q27517|C13A3_CAEEL | Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 | 304 | 484 | 3.0E-26 |
| sp|P33268|CP3A8_MACFA | Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 | 270 | 485 | 4.0E-26 |
| sp|O09158|CP3AP_MOUSE | Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 | 261 | 491 | 5.0E-26 |
| sp|P20815|CP3A5_HUMAN | Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 | 124 | 510 | 5.0E-26 |
| sp|P08684|CP3A4_HUMAN | Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 | 55 | 504 | 1.0E-25 |
| sp|Q07973|CP24A_HUMAN | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 | 118 | 512 | 1.0E-25 |
| sp|P51870|CP4F5_RAT | Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 | 123 | 489 | 1.0E-25 |
| sp|Q09653|C13AA_CAEEL | Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 | 239 | 484 | 2.0E-25 |
| sp|Q9DBW0|CP4V2_MOUSE | Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 | 148 | 512 | 2.0E-25 |
| sp|Q27589|CP4D2_DROME | Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 | 60 | 489 | 6.0E-25 |
| sp|O18993|CP3AL_CALJA | Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 | 270 | 485 | 6.0E-25 |
| sp|Q27516|C13A8_CAEEL | Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 | 304 | 495 | 6.0E-25 |
| sp|Q27593|CP6A8_DROME | Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 | 285 | 483 | 7.0E-25 |
| sp|Q64148|CP3AA_MESAU | Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 | 109 | 484 | 9.0E-25 |
| sp|Q64581|CP3AI_RAT | Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 | 275 | 491 | 1.0E-24 |
| sp|Q27518|C13A2_CAEEL | Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 | 175 | 484 | 1.0E-24 |
| sp|P24462|CP3A7_HUMAN | Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 | 270 | 485 | 1.0E-24 |
| sp|Q00707|STCL_EMENI | Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 | 25 | 475 | 2.0E-24 |
| sp|P79152|CP3AJ_CAPHE | Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 | 308 | 485 | 2.0E-24 |
| sp|O08336|CYPB_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 | 256 | 513 | 2.0E-24 |
| sp|Q64464|CP3AD_MOUSE | Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 | 124 | 500 | 3.0E-24 |
| sp|A2RRT9|CP4V2_RAT | Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 | 148 | 512 | 3.0E-24 |
| sp|P51871|CP4F6_RAT | Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 | 143 | 489 | 6.0E-24 |
| sp|Q9EP75|CP4FE_MOUSE | Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 | 256 | 489 | 7.0E-24 |
| sp|P79102|CP3AS_BOVIN | Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 | 270 | 485 | 7.0E-24 |
| sp|Q9PVE8|C330_FUNHE | Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 | 262 | 483 | 7.0E-24 |
| sp|Q8AXY5|C356_FUNHE | Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 | 262 | 483 | 7.0E-24 |
| sp|Q9UW95|AFLL_ASPPA | Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 | 25 | 483 | 1.0E-23 |
| sp|Q64441|CP24A_MOUSE | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 | 119 | 499 | 2.0E-23 |
| sp|Q9Y6A2|CP46A_HUMAN | Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 | 124 | 484 | 3.0E-23 |
| sp|O48786|C734A_ARATH | Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 | 271 | 484 | 3.0E-23 |
| sp|O42563|CP3AR_ONCMY | Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 | 208 | 513 | 3.0E-23 |
| sp|O49342|C71AD_ARATH | Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 | 223 | 466 | 4.0E-23 |
| sp|Q6ZWL3|CP4V2_HUMAN | Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 | 148 | 512 | 5.0E-23 |
| sp|H2DH17|C7A22_PANGI | Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 | 123 | 483 | 5.0E-23 |
| sp|Q98T91|C340_ORYLA | Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 | 208 | 483 | 2.0E-22 |
| sp|Q5RCN6|CP4V2_PONAB | Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 | 148 | 512 | 3.0E-22 |
| sp|O08394|CYPD_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 | 274 | 512 | 3.0E-22 |
| sp|Q9HB55|CP343_HUMAN | Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 | 270 | 485 | 3.0E-22 |
| sp|P08682|CP2E1_RABIT | Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 | 235 | 512 | 3.0E-22 |
| sp|Q09128|CP24A_RAT | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 | 118 | 499 | 3.0E-22 |
| sp|P51589|CP2J2_HUMAN | Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 | 154 | 491 | 3.0E-22 |
| sp|Q9LUC8|C7A13_ARATH | Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 | 79 | 484 | 5.0E-22 |
| sp|O17624|C13B1_CAEEL | Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 | 272 | 510 | 6.0E-22 |
| sp|Q9WVK8|CP46A_MOUSE | Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 | 124 | 484 | 8.0E-22 |
| sp|P29980|CPXN_NOSS1 | Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 | 272 | 513 | 9.0E-22 |
| sp|P98187|CP4F8_HUMAN | Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 | 274 | 485 | 1.0E-21 |
| sp|Q9SAB6|C71AI_ARATH | Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 | 274 | 484 | 2.0E-21 |
| sp|Q9VS79|CP4D8_DROME | Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 | 148 | 486 | 2.0E-21 |
| sp|P29981|CP4C1_BLADI | Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 | 147 | 512 | 2.0E-21 |
| sp|Q6NT55|CP4FN_HUMAN | Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 | 24 | 481 | 3.0E-21 |
| sp|Q9V771|C6A23_DROME | Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 | 283 | 483 | 3.0E-21 |
| sp|Q9VYQ7|CP311_DROME | Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 | 264 | 495 | 3.0E-21 |
| sp|B5BSX1|BAMO_GLYUR | Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 | 251 | 490 | 3.0E-21 |
| sp|Q964R1|CP6J1_BLAGE | Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 | 278 | 471 | 3.0E-21 |
| sp|Q9LUC6|C7A14_ARATH | Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 | 250 | 484 | 4.0E-21 |
| sp|P79401|CP3AT_PIG | Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 | 270 | 485 | 6.0E-21 |
| sp|Q9LUC5|C7A15_ARATH | Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 | 79 | 484 | 6.0E-21 |
| sp|P15128|CP4B1_RABIT | Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 | 79 | 483 | 7.0E-21 |
| sp|Q9V4U9|C6A13_DROME | Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 | 162 | 483 | 7.0E-21 |
| sp|Q9Y758|CP52M_DEBHN | Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 | 185 | 475 | 9.0E-21 |
| sp|O18635|C12A2_MUSDO | Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 | 239 | 481 | 9.0E-21 |
| sp|P33274|CP4F1_RAT | Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 | 276 | 489 | 1.0E-20 |
| sp|Q9VE00|C12A4_DROME | Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 | 242 | 484 | 1.0E-20 |
| sp|Q42716|C71A8_MENPI | Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 | 274 | 484 | 2.0E-20 |
| sp|Q99N16|CP4F3_MOUSE | Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 | 256 | 489 | 2.0E-20 |
| sp|Q8SPK0|CP4AP_PIG | Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 | 261 | 511 | 2.0E-20 |
| sp|Q9HBI6|CP4FB_HUMAN | Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 | 143 | 489 | 2.0E-20 |
| sp|Q64462|CP4B1_MOUSE | Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 | 243 | 509 | 2.0E-20 |
| sp|P08516|CP4AA_RAT | Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 | 143 | 485 | 3.0E-20 |
| sp|O54750|CP2J6_MOUSE | Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 | 133 | 485 | 3.0E-20 |
| sp|P51869|CP4F4_RAT | Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 | 278 | 489 | 3.0E-20 |
| sp|P49430|THAS_RAT | Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 | 299 | 484 | 3.0E-20 |
| sp|P78329|CP4F2_HUMAN | Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 | 256 | 489 | 4.0E-20 |
| sp|Q9VCW1|CP6D4_DROME | Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 | 176 | 512 | 4.0E-20 |
| sp|O49340|C71AC_ARATH | Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 | 223 | 484 | 4.0E-20 |
| sp|P51590|CP2J3_RAT | Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 | 289 | 485 | 4.0E-20 |
| sp|P37122|C76A2_SOLME | Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 | 136 | 488 | 5.0E-20 |
| sp|Q02318|CP27A_HUMAN | Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 | 146 | 512 | 6.0E-20 |
| sp|Q3MID2|CP4F3_RAT | Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 | 288 | 489 | 6.0E-20 |
| sp|Q9STK7|C71AQ_ARATH | Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 | 125 | 484 | 8.0E-20 |
| sp|Q9V7G5|C4AA1_DROME | Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 | 143 | 492 | 1.0E-19 |
| sp|Q9GJX5|CP4AL_PIG | Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 | 278 | 501 | 1.0E-19 |
| sp|Q9V770|C6A17_DROME | Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 | 284 | 483 | 1.0E-19 |
| sp|Q08477|CP4F3_HUMAN | Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 | 143 | 489 | 1.0E-19 |
| sp|Q9V773|C6A20_DROME | Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 | 285 | 484 | 1.0E-19 |
| sp|Q9FVS9|C96AF_ARATH | Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 | 315 | 512 | 1.0E-19 |
| sp|P52786|CP2J1_RABIT | Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 | 271 | 502 | 2.0E-19 |
| sp|Q964T2|CP9E2_BLAGE | Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 | 305 | 498 | 2.0E-19 |
| sp|Q12612|TRI4_FUSSP | Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 | 17 | 488 | 3.0E-19 |
| sp|O88833|CP4AA_MOUSE | Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 | 278 | 485 | 3.0E-19 |
| sp|Q9HCS2|CP4FC_HUMAN | Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 | 257 | 489 | 4.0E-19 |
| sp|P15129|CP4B1_RAT | Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 | 79 | 510 | 5.0E-19 |
| sp|Q9SHG5|C72C1_ARATH | Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 | 248 | 484 | 5.0E-19 |
| sp|P82712|CCD1P_DROME | Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 | 182 | 503 | 6.0E-19 |
| sp|H1A988|C7254_GLYUR | 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 | 270 | 484 | 6.0E-19 |
| sp|Q9V4U7|C6A14_DROME | Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 | 112 | 499 | 7.0E-19 |
| sp|Q7KR10|CCD1D_DROME | Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 | 182 | 503 | 8.0E-19 |
| sp|P14581|CP4A7_RABIT | Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 | 278 | 485 | 8.0E-19 |
| sp|Q9K498|EIZFM_STRCO | Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 | 251 | 484 | 9.0E-19 |
| sp|P30612|CP52P_CANTR | Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 | 305 | 474 | 1.0E-18 |
| sp|Q9VE01|C12A5_DROME | Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 | 246 | 484 | 1.0E-18 |
| sp|Q1ZXF5|C5084_DICDI | Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 | 272 | 512 | 1.0E-18 |
| sp|Q9STL0|C71AN_ARATH | Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 | 129 | 490 | 1.0E-18 |
| sp|Q9V769|C6A22_DROME | Cytochrome P450 6a22 OS=Drosophila melanogaster GN=Cyp6a22 PE=2 SV=1 | 261 | 483 | 1.0E-18 |
| sp|Q27594|CP6A9_DROME | Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 | 285 | 499 | 1.0E-18 |
| sp|Q8SPK1|CP4AO_PIG | Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 | 261 | 511 | 1.0E-18 |
| sp|P14580|CP4A6_RABIT | Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 | 278 | 485 | 1.0E-18 |
| sp|P13584|CP4B1_HUMAN | Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 | 79 | 483 | 1.0E-18 |
| sp|P30607|CP52B_CANTR | Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 | 305 | 487 | 2.0E-18 |
| sp|H2DH21|C7A29_PANGI | Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 | 249 | 483 | 2.0E-18 |
| sp|P33269|CP4D1_DROME | Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 | 109 | 500 | 2.0E-18 |
| sp|Q9W011|C4D20_DROME | Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 | 113 | 513 | 3.0E-18 |
| sp|Q0IIF9|CP2U1_BOVIN | Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 | 274 | 512 | 3.0E-18 |
| sp|Q9ZW95|C7352_ARATH | Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 | 298 | 483 | 3.0E-18 |
| sp|Q4PJW3|CP51A_BOVIN | Lanosterol 14-alpha demethylase OS=Bos taurus GN=CYP51A1 PE=2 SV=1 | 250 | 512 | 3.0E-18 |
| sp|P93147|C81E1_GLYEC | Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 | 263 | 498 | 3.0E-18 |
| sp|Q9Y8G7|C505_FUSOX | Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 | 286 | 512 | 3.0E-18 |
| sp|Q9ASR3|C7091_ARATH | Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 | 249 | 483 | 3.0E-18 |
| sp|Q4G0S4|C27C1_HUMAN | Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 | 215 | 513 | 3.0E-18 |
| sp|P10632|CP2C8_HUMAN | Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 | 273 | 487 | 4.0E-18 |
| sp|Q86W10|CP4Z1_HUMAN | Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 | 274 | 485 | 4.0E-18 |
| sp|P33270|CP6A2_DROME | Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 | 285 | 491 | 4.0E-18 |
| sp|B9X287|C7346_ORYSJ | Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 | 249 | 484 | 5.0E-18 |
| sp|Q9VA27|CP4C3_DROME | Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 | 284 | 512 | 6.0E-18 |
| sp|P00181|CP2C2_RABIT | Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 | 239 | 486 | 6.0E-18 |
| sp|Q9VLZ7|C4D21_DROME | Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 | 123 | 489 | 6.0E-18 |
| sp|Q27664|CP6B2_HELAM | Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 | 190 | 485 | 7.0E-18 |
| sp|O16805|CP4D1_DROSI | Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 | 109 | 500 | 8.0E-18 |
| sp|Q556M5|C5081_DICDI | Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 | 273 | 512 | 8.0E-18 |
| sp|Q7Z449|CP2U1_HUMAN | Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 | 237 | 512 | 9.0E-18 |
| sp|Q9D816|CP255_MOUSE | Cytochrome P450 2C55 OS=Mus musculus GN=Cyp2c55 PE=1 SV=1 | 225 | 486 | 1.0E-17 |
| sp|P47787|THAS_PIG | Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 | 301 | 484 | 1.0E-17 |
| sp|B9G934|C14C3_ORYSJ | Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 | 310 | 485 | 1.0E-17 |
| sp|P17666|CP2CE_RABIT | Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1 | 225 | 486 | 1.0E-17 |
| sp|F4IK45|C70B2_ARATH | Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 | 249 | 481 | 1.0E-17 |
| sp|Q9V674|CP6G1_DROME | Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 | 305 | 488 | 1.0E-17 |
| sp|P20817|CP4AE_RAT | Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 | 276 | 485 | 1.0E-17 |
| sp|O81972|C82A2_SOYBN | Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 | 174 | 492 | 1.0E-17 |
| sp|Q9LUC9|C7A11_ARATH | Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 | 250 | 484 | 1.0E-17 |
| sp|Q6GUQ4|CP2E1_MACMU | Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 | 235 | 486 | 2.0E-17 |
| sp|P36423|THAS_MOUSE | Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 | 299 | 484 | 2.0E-17 |
| sp|Q2PG45|THAS_MACFA | Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 | 20 | 484 | 2.0E-17 |
| sp|P33266|CP2E1_MACFA | Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 | 238 | 486 | 2.0E-17 |
| sp|Q6R7M4|C15A1_DIPPU | Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 | 263 | 498 | 2.0E-17 |
| sp|Q9T0K2|C71AK_ARATH | Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 | 236 | 489 | 2.0E-17 |
| sp|P9WPN3|CP132_MYCTU | Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 | 159 | 483 | 2.0E-17 |
| sp|O81117|C94A1_VICSA | Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 | 125 | 512 | 2.0E-17 |
| sp|P20816|CP4A2_RAT | Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 | 276 | 485 | 2.0E-17 |
| sp|H1A981|C7263_MEDTR | 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 | 295 | 484 | 2.0E-17 |
| sp|P9WPN2|CP132_MYCTO | Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 | 159 | 483 | 3.0E-17 |
| sp|P59954|CP132_MYCBO | Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 | 159 | 483 | 3.0E-17 |
| sp|Q05047|C72A1_CATRO | Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 | 250 | 483 | 3.0E-17 |
| sp|Q9VVR9|C12C1_DROME | Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 | 136 | 484 | 4.0E-17 |
| sp|P82711|C6A19_DROME | Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 | 286 | 484 | 4.0E-17 |
| sp|P48419|C75A3_PETHY | Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 | 240 | 498 | 4.0E-17 |
| sp|Q43068|C82A1_PEA | Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 | 275 | 491 | 4.0E-17 |
| sp|Q9VQD2|CP391_DROME | Probable cytochrome P450 309a1 OS=Drosophila melanogaster GN=Cyp309a1 PE=1 SV=4 | 244 | 486 | 5.0E-17 |
| sp|O93323|CP26A_XENLA | Cytochrome P450 26A1 OS=Xenopus laevis GN=cyp26a1 PE=2 SV=1 | 258 | 493 | 5.0E-17 |
| sp|C0SJS3|ANGS_PASSA | Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 | 278 | 489 | 6.0E-17 |
| sp|P24464|CP4AC_RAT | Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 | 276 | 485 | 6.0E-17 |
| sp|Q93VK5|LUT5_ARATH | Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 | 300 | 484 | 6.0E-17 |
| sp|Q9SD85|F3PH_ARATH | Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 | 274 | 484 | 7.0E-17 |
| sp|Q9VL92|CP4E3_DROME | Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 | 124 | 499 | 7.0E-17 |
| sp|Q50EK4|C75A1_PINTA | Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 | 279 | 504 | 8.0E-17 |
| sp|Q6UEG2|AFLN_ASPPA | P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 | 309 | 485 | 8.0E-17 |
| sp|Q02928|CP4AB_HUMAN | Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 | 261 | 511 | 8.0E-17 |
| sp|P33273|CP255_RAT | Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 | 242 | 484 | 9.0E-17 |
| sp|P48422|C86A1_ARATH | Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 | 125 | 486 | 1.0E-16 |
| sp|Q01361|CP2DE_BOVIN | Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 | 167 | 483 | 1.0E-16 |
| sp|P14579|CP4A5_RABIT | Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 | 278 | 485 | 1.0E-16 |
| sp|Q9SBQ9|F3PH_PETHY | Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 | 287 | 483 | 1.0E-16 |
| sp|Q64429|CP1B1_MOUSE | Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 | 222 | 512 | 1.0E-16 |
| sp|O46051|C4D14_DROME | Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 | 283 | 489 | 1.0E-16 |
| sp|Q9FF18|C7351_ARATH | Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 | 121 | 483 | 1.0E-16 |
| sp|P82713|CP392_DROME | Probable cytochrome P450 309a2 OS=Drosophila melanogaster GN=Cyp309a2 PE=2 SV=2 | 173 | 471 | 1.0E-16 |
| sp|Q64678|CP1B1_RAT | Cytochrome P450 1B1 OS=Rattus norvegicus GN=Cyp1b1 PE=1 SV=1 | 222 | 512 | 1.0E-16 |
| sp|O54749|CP2J5_MOUSE | Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 | 287 | 503 | 1.0E-16 |
| sp|P33265|CP2CS_MESAU | Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 | 242 | 486 | 1.0E-16 |
| sp|P00180|CP2C1_RABIT | Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 | 226 | 486 | 1.0E-16 |
| sp|Q6NKZ8|C14A2_ARATH | Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 | 274 | 483 | 1.0E-16 |
| sp|Q9VGZ0|C12E1_DROME | Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 | 241 | 482 | 2.0E-16 |
| sp|O65438|C71AR_ARATH | Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 | 261 | 484 | 2.0E-16 |
| sp|Q9FMY1|C86B1_ARATH | Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 | 113 | 491 | 2.0E-16 |
| sp|P05182|CP2E1_RAT | Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 | 235 | 486 | 2.0E-16 |
| sp|P05181|CP2E1_HUMAN | Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 | 242 | 486 | 2.0E-16 |
| sp|P51581|CP2E1_MESAU | Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 | 235 | 486 | 2.0E-16 |
| sp|D5JBW9|GAO_SAUCO | Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 | 280 | 484 | 2.0E-16 |
| sp|P00182|CP2C3_RABIT | Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 | 242 | 486 | 2.0E-16 |
| sp|O18963|CP2E1_BOVIN | Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 | 235 | 512 | 2.0E-16 |
| sp|Q50EK3|C04C1_PINTA | Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 | 124 | 491 | 2.0E-16 |
| sp|Q9DBG1|CP27A_MOUSE | Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 | 145 | 481 | 2.0E-16 |
| sp|D5J9U8|GAO_LACSA | Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 | 280 | 484 | 2.0E-16 |
| sp|P11715|CP17A_RAT | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 | 225 | 509 | 2.0E-16 |
| sp|P13108|CP2D4_RAT | Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 | 282 | 483 | 2.0E-16 |
| sp|Q08078|CP2CP_MESAU | Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 | 263 | 486 | 2.0E-16 |
| sp|P08686|CP21A_HUMAN | Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 | 130 | 485 | 2.0E-16 |
| sp|Q91Z85|CP17A_PERLE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 | 236 | 509 | 2.0E-16 |
| sp|O18596|C4D10_DROMT | Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 | 124 | 512 | 3.0E-16 |
| sp|P24557|THAS_HUMAN | Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 | 20 | 484 | 3.0E-16 |
| sp|P10611|CP4A4_RABIT | Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 | 143 | 485 | 3.0E-16 |
| sp|P33262|CP2CK_MACFA | Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 | 228 | 484 | 3.0E-16 |
| sp|Q556M4|C5082_DICDI | Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 | 265 | 513 | 3.0E-16 |
| sp|P48418|C75A1_PETHY | Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 | 286 | 498 | 3.0E-16 |
| sp|O49858|C82A3_SOYBN | Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 | 126 | 491 | 4.0E-16 |
| sp|Q9V979|CP6U1_DROME | Probable cytochrome P450 6u1 OS=Drosophila melanogaster GN=Cyp6u1 PE=2 SV=3 | 285 | 485 | 4.0E-16 |
| sp|Q12581|CP52X_CANMA | Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 | 317 | 487 | 4.0E-16 |
| sp|Q6QNI4|C71AJ_AMMMJ | Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 | 222 | 489 | 4.0E-16 |
| sp|D5JBX0|GAO_HELAN | Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 | 264 | 472 | 4.0E-16 |
| sp|D5JBW8|GAO_CICIN | Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 | 280 | 484 | 4.0E-16 |
| sp|P11711|CP2A1_RAT | Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 | 243 | 491 | 4.0E-16 |
| sp|Q93Z79|C14A1_ARATH | Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 | 274 | 483 | 4.0E-16 |
| sp|Q964Q7|CP6D3_MUSDO | Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 | 157 | 486 | 4.0E-16 |
| sp|Q9C788|C70B1_ARATH | Cytochrome P450 704B1 OS=Arabidopsis thaliana GN=CYP704B1 PE=1 SV=1 | 124 | 512 | 4.0E-16 |
| sp|P56654|CP237_MOUSE | Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 | 225 | 486 | 5.0E-16 |
| sp|Q64403|CP2DG_CAVPO | Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16 PE=1 SV=1 | 281 | 483 | 5.0E-16 |
| sp|O61387|CP6B7_HELAM | Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 | 182 | 485 | 5.0E-16 |
| sp|Q27698|CP6D1_MUSDO | Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 | 283 | 491 | 5.0E-16 |
| sp|P05177|CP1A2_HUMAN | Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 | 30 | 512 | 5.0E-16 |
| sp|P11714|CP2D9_MOUSE | Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 | 289 | 489 | 6.0E-16 |
| sp|P33263|CP2CQ_MESAU | Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 | 263 | 502 | 6.0E-16 |
| sp|P27786|CP17A_MOUSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 | 225 | 509 | 6.0E-16 |
| sp|Q9ZUX1|C94C1_ARATH | Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 | 256 | 481 | 6.0E-16 |
| sp|Q8VWZ7|C76B6_CATRO | Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 | 274 | 484 | 6.0E-16 |
| sp|Q9QYG5|CP2DK_MESAU | Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 | 289 | 483 | 6.0E-16 |
| sp|P05176|CP1A1_RABIT | Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 | 249 | 484 | 6.0E-16 |
| sp|Q5TCH4|CP4AM_HUMAN | Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 | 261 | 485 | 7.0E-16 |
| sp|P10615|CP52A_CANTR | Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 | 256 | 475 | 7.0E-16 |
| sp|Q4R8S6|CP51A_MACFA | Lanosterol 14-alpha demethylase OS=Macaca fascicularis GN=CYP51A1 PE=2 SV=2 | 250 | 488 | 7.0E-16 |
| sp|Q9V776|CP317_DROME | Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 | 285 | 462 | 7.0E-16 |
| sp|Q2LA60|CP21A_FELCA | Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 | 130 | 485 | 7.0E-16 |
| sp|Q16850|CP51A_HUMAN | Lanosterol 14-alpha demethylase OS=Homo sapiens GN=CYP51A1 PE=1 SV=3 | 250 | 488 | 8.0E-16 |
| sp|P17178|CP27A_RAT | Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 | 145 | 512 | 8.0E-16 |
| sp|Q04552|CP6B1_PAPPO | Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 | 284 | 485 | 9.0E-16 |
| sp|Q9QYG6|CP2DR_MESAU | Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 | 289 | 483 | 9.0E-16 |
| sp|Q9LHA1|C8D11_ARATH | Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 | 317 | 474 | 9.0E-16 |
| sp|E3W9C4|C71A1_ZINZE | Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 | 288 | 466 | 9.0E-16 |
| sp|Q64680|CP2DI_RAT | Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 | 282 | 483 | 1.0E-15 |
| sp|B9GBJ9|C14C1_ORYSJ | Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 | 310 | 485 | 1.0E-15 |
| sp|Q50LH4|C7193_ESCCA | (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 | 247 | 487 | 1.0E-15 |
| sp|O35728|CP4AE_MOUSE | Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 | 276 | 513 | 1.0E-15 |
| sp|Q6VVX0|CP2R1_HUMAN | Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 | 289 | 481 | 1.0E-15 |
| sp|Q96581|C75A4_GENTR | Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 | 284 | 498 | 1.0E-15 |
| sp|Q5RE72|CP51A_PONAB | Lanosterol 14-alpha demethylase OS=Pongo abelii GN=CYP51A1 PE=2 SV=2 | 250 | 488 | 1.0E-15 |
| sp|O46658|CP2DP_PIG | Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 | 167 | 483 | 1.0E-15 |
| sp|P33264|CP2CR_MESAU | Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 | 263 | 495 | 1.0E-15 |
| sp|C0SJS2|C71AJ_PASSA | Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 | 262 | 489 | 1.0E-15 |
| sp|Q55AJ4|C516B_DICDI | Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 | 250 | 491 | 1.0E-15 |
| sp|O46420|CP51A_PIG | Lanosterol 14-alpha demethylase OS=Sus scrofa GN=CYP51A1 PE=2 SV=1 | 250 | 488 | 1.0E-15 |
| sp|Q9CX98|CP2U1_MOUSE | Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 | 237 | 512 | 1.0E-15 |
| sp|P58046|C71AF_ARATH | Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 | 234 | 488 | 1.0E-15 |
| sp|Q8CIM7|CP2DQ_MOUSE | Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 | 232 | 489 | 2.0E-15 |
| sp|Q16678|CP1B1_HUMAN | Cytochrome P450 1B1 OS=Homo sapiens GN=CYP1B1 PE=1 SV=2 | 188 | 509 | 2.0E-15 |
| sp|P79402|CP242_PIG | Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 | 266 | 502 | 2.0E-15 |
| sp|Q6WNQ8|C81E8_MEDTR | Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 | 317 | 467 | 2.0E-15 |
| sp|Q91WL5|CP4CA_MOUSE | Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 | 288 | 511 | 3.0E-15 |
| sp|D5JBX1|GAO_BARSP | Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 | 280 | 472 | 3.0E-15 |
| sp|Q1ZXL2|C518B_DICDI | Probable cytochrome P450 518B1 OS=Dictyostelium discoideum GN=cyp518B1 PE=3 SV=1 | 224 | 512 | 3.0E-15 |
| sp|Q95031|CP6B6_HELAM | Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 | 280 | 485 | 3.0E-15 |
| sp|Q2LA59|CP21A_LYNLY | Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 | 130 | 485 | 3.0E-15 |
| sp|Q27902|CP6B4_PAPGL | Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 | 281 | 485 | 3.0E-15 |
| sp|Q95036|CP6B5_PAPGL | Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 | 281 | 485 | 4.0E-15 |
| sp|Q92113|CP17A_SQUAC | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 | 319 | 513 | 4.0E-15 |
| sp|P16496|CP52C_CANMA | Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 | 256 | 481 | 4.0E-15 |
| sp|P37120|C75A2_SOLME | Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 | 258 | 484 | 4.0E-15 |
| sp|Q59990|CP120_SYNY3 | Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 | 222 | 481 | 4.0E-15 |
| sp|P20678|CP2H2_CHICK | Cytochrome P450 2H2 OS=Gallus gallus GN=CYP2H2 PE=1 SV=1 | 250 | 486 | 5.0E-15 |
| sp|O64636|C76C1_ARATH | Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 | 155 | 483 | 5.0E-15 |
| sp|P56590|CP1A1_CANLF | Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 | 249 | 483 | 5.0E-15 |
| sp|Q9C5Y2|KAO2_ARATH | Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 | 244 | 481 | 5.0E-15 |
| sp|Q9MZY0|CP2E1_CANLF | Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 | 246 | 486 | 5.0E-15 |
| sp|P30608|CP52F_CANTR | Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 | 317 | 469 | 5.0E-15 |
| sp|P56593|CP2AC_MOUSE | Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 | 170 | 484 | 5.0E-15 |
| sp|P79383|CP2E1_PIG | Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 | 247 | 486 | 5.0E-15 |
| sp|O55071|CP2BJ_MOUSE | Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 | 258 | 494 | 5.0E-15 |
| sp|P15149|CP2A2_RAT | Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 | 243 | 491 | 6.0E-15 |
| sp|Q5KQT7|CP1A1_FELCA | Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 | 249 | 483 | 6.0E-15 |
| sp|P00185|CP1A1_RAT | Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 | 222 | 491 | 6.0E-15 |
| sp|Q4V8D1|CP2U1_RAT | Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 | 237 | 512 | 6.0E-15 |
| sp|O62671|CP241_CANLF | Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 | 242 | 486 | 6.0E-15 |
| sp|Q05421|CP2E1_MOUSE | Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 | 235 | 486 | 6.0E-15 |
| sp|P24460|CP2BB_CANLF | Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 | 244 | 491 | 6.0E-15 |
| sp|Q9V6H1|CP9H1_DROME | Probable cytochrome P450 9h1 OS=Drosophila melanogaster GN=Cyp9h1 PE=3 SV=1 | 307 | 485 | 7.0E-15 |
| sp|Q27756|CP6B3_PAPPO | Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 | 309 | 490 | 7.0E-15 |
| sp|Q078T0|PHACB_EMEND | 3-hydroxyphenylacetate 6-hydroxylase OS=Emericella nidulans GN=phacB PE=1 SV=1 | 304 | 487 | 7.0E-15 |
| sp|Q9FG65|C81D1_ARATH | Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 | 317 | 467 | 7.0E-15 |
| sp|P12790|CP2B9_MOUSE | Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 | 280 | 482 | 7.0E-15 |
| sp|P33272|CP2BC_RAT | Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 | 249 | 482 | 7.0E-15 |
| sp|Q9GQM9|CP6L1_BLAGE | Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 | 304 | 473 | 7.0E-15 |
| sp|P00179|CP2C5_RABIT | Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 | 242 | 502 | 7.0E-15 |
| sp|Q54DT2|C516A_DICDI | Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 | 222 | 491 | 7.0E-15 |
| sp|P00184|CP1A1_MOUSE | Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 | 222 | 491 | 7.0E-15 |
| sp|Q9V6D6|CP301_DROME | Probable cytochrome P450 301a1, mitochondrial OS=Drosophila melanogaster GN=Cyp301a1 PE=2 SV=1 | 119 | 500 | 8.0E-15 |
| sp|D4AY62|A1131_ARTBC | Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 | 116 | 470 | 8.0E-15 |
| sp|P93530|C71D6_SOLCH | Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 | 283 | 466 | 8.0E-15 |
| sp|Q2KIG5|THAS_BOVIN | Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 | 301 | 462 | 8.0E-15 |
| sp|O64635|C76C4_ARATH | Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 | 155 | 483 | 8.0E-15 |
| sp|Q6VVW9|CP2R1_MOUSE | Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 | 289 | 512 | 8.0E-15 |
| sp|P24458|CP52E_CANMA | Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 | 245 | 481 | 9.0E-15 |
| sp|P48421|C83A1_ARATH | Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 | 307 | 484 | 9.0E-15 |
| sp|Q92087|CP19A_ORYLA | Aromatase OS=Oryzias latipes GN=cyp19a1 PE=2 SV=1 | 271 | 488 | 9.0E-15 |
| sp|Q9VGB5|CP135_DROME | Probable cytochrome P450 313a5 OS=Drosophila melanogaster GN=Cyp313a5 PE=1 SV=2 | 116 | 481 | 9.0E-15 |
| sp|Q1ZXL7|C5083_DICDI | Probable cytochrome P450 508A3 OS=Dictyostelium discoideum GN=cyp508A3-1 PE=3 SV=1 | 265 | 491 | 9.0E-15 |
| sp|P11712|CP2C9_HUMAN | Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 | 242 | 486 | 9.0E-15 |
| sp|Q8N118|CP4X1_HUMAN | Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 | 256 | 502 | 9.0E-15 |
| sp|O77810|CP1A2_CALJA | Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 | 129 | 513 | 1.0E-14 |
| sp|Q964T1|CP4CU_BLAGE | Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 | 284 | 487 | 1.0E-14 |
| sp|P15540|CP21A_PIG | Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 | 130 | 485 | 1.0E-14 |
| sp|P10634|CP2DQ_RAT | Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 | 266 | 483 | 1.0E-14 |
| sp|Q94FM7|C71DK_TOBAC | 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 | 283 | 472 | 1.0E-14 |
| sp|Q64654|CP51A_RAT | Lanosterol 14-alpha demethylase OS=Rattus norvegicus GN=Cyp51a1 PE=2 SV=1 | 250 | 483 | 1.0E-14 |
| sp|Q9PUB4|CP26A_CHICK | Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 PE=2 SV=1 | 258 | 488 | 1.0E-14 |
| sp|Q9LTM6|C71BH_ARATH | Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 | 124 | 466 | 1.0E-14 |
| sp|Q6JZS3|CP1A1_ORYLA | Cytochrome P450 1A1 OS=Oryzias latipes GN=cyp1a1 PE=3 SV=1 | 32 | 512 | 1.0E-14 |
| sp|Q92109|CP1A3_ONCMY | Cytochrome P450 1A3 OS=Oncorhynchus mykiss GN=cyp1a3 PE=2 SV=2 | 66 | 512 | 1.0E-14 |
| sp|Q9STL1|C71AM_ARATH | Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 | 285 | 484 | 1.0E-14 |
| sp|H2DH24|C7D47_PANGI | Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 | 264 | 476 | 1.0E-14 |
| sp|Q9V559|CP4P3_DROME | Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 | 241 | 513 | 1.0E-14 |
| sp|P00176|CP2B1_RAT | Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 | 243 | 482 | 1.0E-14 |
| sp|Q6TBX7|LUT1_ARATH | Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 | 306 | 484 | 1.0E-14 |
| sp|Q9VYT8|C28C1_DROME | Probable cytochrome P450 28c1 OS=Drosophila melanogaster GN=Cyp28c1 PE=2 SV=1 | 232 | 462 | 1.0E-14 |
| sp|Q9VFP1|CP6D5_DROME | Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 | 295 | 484 | 1.0E-14 |
| sp|E1B2Z9|C7AV8_CICIN | Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 | 280 | 472 | 2.0E-14 |
| sp|Q9VYY4|C4G15_DROME | Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 | 283 | 498 | 2.0E-14 |
| sp|Q8K0C4|CP51A_MOUSE | Lanosterol 14-alpha demethylase OS=Mus musculus GN=Cyp51a1 PE=1 SV=1 | 250 | 483 | 2.0E-14 |
| sp|Q0DS59|C14B2_ORYSJ | Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 | 249 | 484 | 2.0E-14 |
| sp|Q82IY3|PTLI_STRAW | Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 | 285 | 476 | 2.0E-14 |
| sp|Q9SMP5|C94B3_ARATH | Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 | 123 | 512 | 2.0E-14 |
| sp|P33260|CP2CI_HUMAN | Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 | 266 | 502 | 2.0E-14 |
| sp|Q9T093|C70B3_ARATH | Cytochrome P450 709B3 OS=Arabidopsis thaliana GN=CYP709B3 PE=2 SV=1 | 170 | 483 | 2.0E-14 |
| sp|P98188|C94A2_VICSA | Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 | 125 | 491 | 2.0E-14 |
| sp|O80823|C86A8_ARATH | Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 | 125 | 508 | 2.0E-14 |
| sp|Q9VHP4|CP313_DROME | Probable cytochrome P450 313b1 OS=Drosophila melanogaster GN=Cyp313b1 PE=2 SV=2 | 79 | 481 | 2.0E-14 |
| sp|Q96418|C75A5_EUSER | Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 | 288 | 484 | 2.0E-14 |
| sp|D1MI46|C76BA_SWEMU | Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 | 267 | 466 | 2.0E-14 |
| sp|Q00714|STCS_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 | 287 | 485 | 3.0E-14 |
| sp|O44221|CP4E5_DROMT | Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 | 78 | 500 | 3.0E-14 |
| sp|Q6WNR0|C81E7_MEDTR | Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 | 284 | 498 | 3.0E-14 |
| sp|Q7X7X4|C99A2_ORYSJ | Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 | 303 | 501 | 3.0E-14 |
| sp|P24461|CP2G1_RABIT | Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 | 242 | 486 | 3.0E-14 |
| sp|Q9Y757|CP52L_DEBHN | Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 | 317 | 481 | 3.0E-14 |
| sp|Q9STK9|C71AO_ARATH | Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 | 271 | 483 | 3.0E-14 |
| sp|Q92088|CP2M1_ONCMY | Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 | 280 | 483 | 4.0E-14 |
| sp|Q00557|CP1A1_MESAU | Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 | 222 | 491 | 4.0E-14 |
| sp|Q29510|CP2CU_RABIT | Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 | 242 | 502 | 4.0E-14 |
| sp|Q27606|CP4E2_DROME | Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 | 249 | 499 | 5.0E-14 |
| sp|P33261|CP2CJ_HUMAN | Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 | 271 | 502 | 5.0E-14 |
| sp|Q9QUJ1|CP2DS_MESAU | Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 | 289 | 503 | 5.0E-14 |
| sp|O15528|CP27B_HUMAN | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 | 302 | 490 | 5.0E-14 |
| sp|Q2LCM1|CP21A_CANLU | Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 | 130 | 485 | 5.0E-14 |
| sp|Q8WNW0|CP21A_CANLF | Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 | 130 | 485 | 5.0E-14 |
| sp|Q6QHT9|CP19A_ANGJA | Aromatase OS=Anguilla japonica GN=cyp19a1 PE=2 SV=1 | 269 | 496 | 5.0E-14 |
| sp|Q12587|CP52Q_CANMA | Cytochrome P450 52C2 OS=Candida maltosa GN=CYP52C2 PE=2 SV=1 | 305 | 482 | 5.0E-14 |
| sp|Q3LFU0|CP1A1_BALAC | Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 | 113 | 484 | 5.0E-14 |
| sp|B9DFU2|MAX1_ARATH | Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 | 162 | 484 | 5.0E-14 |
| sp|P19225|CP270_RAT | Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 | 256 | 486 | 5.0E-14 |
| sp|P04167|CP2B2_RAT | Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 | 243 | 482 | 6.0E-14 |
| sp|Q5KQH7|C14D1_ORYSJ | Cytochrome P450 714D1 OS=Oryza sativa subsp. japonica GN=CYP714D1 PE=1 SV=1 | 282 | 483 | 6.0E-14 |
| sp|P13527|CP6A1_MUSDO | Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 | 285 | 483 | 6.0E-14 |
| sp|P17177|CP27A_RABIT | Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 | 113 | 483 | 6.0E-14 |
| sp|P9WPM1|CP139_MYCTU | Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 | 90 | 484 | 6.0E-14 |
| sp|P9WPM0|CP139_MYCTO | Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 | 90 | 484 | 6.0E-14 |
| sp|P63720|CP139_MYCBO | Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 | 90 | 484 | 6.0E-14 |
| sp|Q50LH3|C7192_ESCCA | (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 | 315 | 484 | 6.0E-14 |
| sp|I7CT85|C7A53_PANGI | Protopanaxadiol 6-hydroxylase OS=Panax ginseng PE=1 SV=1 | 251 | 473 | 6.0E-14 |
| sp|Q9VGB3|CP133_DROME | Probable cytochrome P450 313a3 OS=Drosophila melanogaster GN=Cyp313a3 PE=3 SV=2 | 263 | 503 | 6.0E-14 |
| sp|Q12588|CP52J_CANMA | Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 | 317 | 490 | 6.0E-14 |
| sp|Q8TAV3|CP2W1_HUMAN | Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 | 282 | 485 | 7.0E-14 |
| sp|Q92110|CP1A1_ONCMY | Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1a1 PE=2 SV=2 | 66 | 512 | 7.0E-14 |
| sp|Q64410|CP17A_CAVPO | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 | 235 | 509 | 7.0E-14 |
| sp|Q5RBQ1|CP1A2_PONAB | Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 | 249 | 513 | 7.0E-14 |
| sp|Q29488|CP2DH_MACFA | Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1 | 277 | 483 | 7.0E-14 |
| sp|P24470|CP2CN_RAT | Cytochrome P450 2C23 OS=Rattus norvegicus GN=Cyp2c23 PE=2 SV=2 | 220 | 495 | 8.0E-14 |
| sp|P20852|CP2A5_MOUSE | Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 | 289 | 488 | 8.0E-14 |
| sp|C0SJS4|C71AJ_APIGR | Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 | 280 | 489 | 8.0E-14 |
| sp|Q9V4I0|CP9B1_DROME | Cytochrome P450 9b1 OS=Drosophila melanogaster GN=Cyp9b1 PE=2 SV=1 | 1 | 471 | 8.0E-14 |
| sp|B6SSW8|C14B3_MAIZE | Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 | 311 | 484 | 8.0E-14 |
| sp|Q9CAD6|C86A7_ARATH | Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 | 125 | 481 | 8.0E-14 |
| sp|O77809|CP1A2_MACFA | Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 | 249 | 513 | 9.0E-14 |
| sp|A6YIH8|C7D55_HYOMU | Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 | 283 | 462 | 9.0E-14 |
| sp|P70687|CP17A_MESAU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 | 241 | 509 | 1.0E-13 |
| sp|Q9VFJ0|CA131_DROME | Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 | 308 | 481 | 1.0E-13 |
| sp|Q2XNC8|CP2D6_PANTR | Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1 | 277 | 483 | 1.0E-13 |
| sp|P56656|CP239_MOUSE | Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 | 242 | 512 | 1.0E-13 |
| sp|Q69XM6|C7344_ORYSJ | Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 | 288 | 483 | 1.0E-13 |
| sp|Q9V3S0|CP4G1_DROME | Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 | 283 | 513 | 1.0E-13 |
| sp|O04790|C75A7_EUSER | Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 | 288 | 498 | 1.0E-13 |
| sp|P10635|CP2D6_HUMAN | Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 | 277 | 483 | 1.0E-13 |
| sp|Q9NGX9|CP302_DROME | Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2 | 249 | 472 | 1.0E-13 |
| sp|Q9LTM7|C71BG_ARATH | Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 | 114 | 466 | 1.0E-13 |
| sp|O35293|CP2F2_RAT | Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 | 242 | 486 | 1.0E-13 |
| sp|O04164|C71A6_NEPRA | Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 | 129 | 484 | 1.0E-13 |
| sp|Q6WG30|T5H_TAXCU | Taxadiene 5-alpha hydroxylase OS=Taxus cuspidata PE=1 SV=2 | 251 | 489 | 1.0E-13 |
| sp|P58045|C71AE_ARATH | Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=CYP71A14 PE=2 SV=1 | 240 | 484 | 1.0E-13 |
| sp|Q54CS3|C508C_DICDI | Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508C1 PE=3 SV=1 | 252 | 491 | 1.0E-13 |
| sp|P56594|CP2CL_CANLF | Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 | 235 | 486 | 1.0E-13 |
| sp|Q9VMS9|C4AC1_DROME | Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 | 283 | 512 | 1.0E-13 |
| sp|Q92095|CP1A1_OPSTA | Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 | 66 | 512 | 2.0E-13 |
| sp|P12938|CP2D3_RAT | Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2 | 168 | 483 | 2.0E-13 |
| sp|Q9V774|C6A21_DROME | Probable cytochrome P450 6a21 OS=Drosophila melanogaster GN=Cyp6a21 PE=2 SV=1 | 285 | 499 | 2.0E-13 |
| sp|P00191|CP21A_BOVIN | Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 | 126 | 485 | 2.0E-13 |
| sp|Q2XNC9|CP2D6_PANPA | Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1 | 277 | 483 | 2.0E-13 |
| sp|Q9STL2|C71AL_ARATH | Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 | 285 | 489 | 2.0E-13 |
| sp|P93531|C71D7_SOLCH | Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 | 283 | 462 | 2.0E-13 |
| sp|Q9V8M2|C12B2_DROME | Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 | 317 | 494 | 2.0E-13 |
| sp|Q9YH64|CP1A1_PLAFE | Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 | 66 | 512 | 2.0E-13 |
| sp|L7X0L7|P6H_PAPSO | Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 | 158 | 491 | 2.0E-13 |
| sp|P56657|CP240_MOUSE | Cytochrome P450 2C40 OS=Mus musculus GN=Cyp2c40 PE=1 SV=2 | 266 | 486 | 2.0E-13 |
| sp|Q9T0K0|C71AJ_ARATH | Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 | 317 | 489 | 2.0E-13 |
| sp|P58048|C71B8_ARATH | Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 | 274 | 472 | 2.0E-13 |
| sp|O23051|KAO1_ARATH | Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 | 244 | 490 | 2.0E-13 |
| sp|P33267|CP2F2_MOUSE | Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 | 271 | 491 | 2.0E-13 |
| sp|P12394|CP17A_CHICK | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 | 188 | 487 | 2.0E-13 |
| sp|O18809|CP2F3_CAPHI | Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 | 242 | 488 | 3.0E-13 |
| sp|C0SPF7|C15C1_BOMMO | Farnesoate epoxidase OS=Bombyx mori GN=CYP15C1 PE=1 SV=2 | 236 | 484 | 3.0E-13 |
| sp|P11371|CP2C4_RABIT | Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 | 242 | 502 | 3.0E-13 |
| sp|P00187|CP1A2_RABIT | Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 | 249 | 483 | 3.0E-13 |
| sp|P43083|CP52V_CANAP | Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 | 282 | 469 | 3.0E-13 |
| sp|A3A871|C71Z6_ORYSJ | Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 | 288 | 484 | 3.0E-13 |
| sp|Q6YTF1|C76M8_ORYSJ | Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 | 288 | 484 | 3.0E-13 |
| sp|E9Q816|CP2W1_MOUSE | Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 | 260 | 485 | 3.0E-13 |
| sp|Q12589|CP52K_CANMA | Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 | 317 | 469 | 3.0E-13 |
| sp|Q64458|CP2CT_MOUSE | Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 | 242 | 486 | 3.0E-13 |
| sp|Q6XVG2|CP254_MOUSE | Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 | 225 | 486 | 4.0E-13 |
| sp|Q6Z6D6|C7342_ORYSJ | Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 | 307 | 484 | 4.0E-13 |
| sp|F2Z9C1|P6H_ESCCA | Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 | 279 | 491 | 4.0E-13 |
| sp|P05179|CP2C7_RAT | Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 | 263 | 502 | 4.0E-13 |
| sp|Q69X58|C76M7_ORYSJ | Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 | 256 | 484 | 4.0E-13 |
| sp|P13107|CP2B3_RAT | Cytochrome P450 2B3 OS=Rattus norvegicus GN=Cyp2b3 PE=2 SV=1 | 317 | 501 | 4.0E-13 |
| sp|O42430|CP1A1_LIMLI | Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 | 66 | 512 | 5.0E-13 |
| sp|Q9V9L1|CP6W1_DROME | Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 | 188 | 487 | 5.0E-13 |
| sp|P24465|C71A1_PERAE | Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 | 283 | 462 | 5.0E-13 |
| sp|P08683|CP2CB_RAT | Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 | 266 | 486 | 5.0E-13 |
| sp|Q9LMM1|C86A4_ARATH | Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 | 125 | 499 | 5.0E-13 |
| sp|Q8HYM9|CP17A_MACMU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 | 225 | 489 | 5.0E-13 |
| sp|Q2XVA1|CP17A_MACFA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 | 225 | 489 | 5.0E-13 |
| sp|O46054|C4AE1_DROME | Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 | 301 | 512 | 5.0E-13 |
| sp|P04798|CP1A1_HUMAN | Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 | 249 | 483 | 5.0E-13 |
| sp|Q8HYN0|CP17A_PAPCY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 | 225 | 489 | 6.0E-13 |
| sp|Q27712|CP2L1_PANAR | Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 | 280 | 491 | 6.0E-13 |
| sp|Q42799|C93A2_SOYBN | Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 | 275 | 466 | 6.0E-13 |
| sp|P20812|CP2A3_RAT | Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 | 289 | 484 | 7.0E-13 |
| sp|Q501D8|C79B3_ARATH | Tryptophan N-monooxygenase 2 OS=Arabidopsis thaliana GN=CYP79B3 PE=1 SV=1 | 288 | 502 | 7.0E-13 |
| sp|P20813|CP2B6_HUMAN | Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1 SV=1 | 234 | 482 | 7.0E-13 |
| sp|Q16696|CP2AD_HUMAN | Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 | 289 | 484 | 7.0E-13 |
| sp|P11509|CP2A6_HUMAN | Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 | 289 | 481 | 7.0E-13 |
| sp|P24457|CP2DB_MOUSE | Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 | 289 | 489 | 7.0E-13 |
| sp|Q4H4C3|CP1A2_MACFU | Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 | 249 | 513 | 8.0E-13 |
| sp|Q9VMS7|C4AC3_DROME | Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 | 283 | 512 | 8.0E-13 |
| sp|P24456|CP2DA_MOUSE | Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 | 289 | 483 | 8.0E-13 |
| sp|B1NF19|C719D_ARGME | (S)-stylopine synthase OS=Argemone mexicana GN=CYP719A13 PE=1 SV=1 | 315 | 483 | 8.0E-13 |
| sp|Q92116|CP1A1_STECH | Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 | 249 | 512 | 8.0E-13 |
| sp|Q9STK8|C71AP_ARATH | Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 | 301 | 466 | 8.0E-13 |
| sp|P16141|CP52D_CANMA | Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 | 256 | 490 | 8.0E-13 |
| sp|P79304|CP193_PIG | Aromatase 3 OS=Sus scrofa GN=CYP19A3 PE=2 SV=2 | 252 | 491 | 8.0E-13 |
| sp|O65787|C71B6_ARATH | Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 | 257 | 460 | 8.0E-13 |
| sp|P58047|C71AS_ARATH | Putative cytochrome P450 71A28 OS=Arabidopsis thaliana GN=CYP71A28 PE=3 SV=2 | 274 | 484 | 8.0E-13 |
| sp|P24903|CP2F1_HUMAN | Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 | 289 | 488 | 8.0E-13 |
| sp|Q9V4T5|CP4E1_DROME | Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 | 124 | 499 | 9.0E-13 |
| sp|Q9V4I1|CP9B2_DROME | Cytochrome P450 9b2 OS=Drosophila melanogaster GN=Cyp9b2 PE=2 SV=1 | 286 | 471 | 9.0E-13 |
| sp|Q9VG17|CP304_DROME | Probable cytochrome P450 304a1 OS=Drosophila melanogaster GN=Cyp304a1 PE=2 SV=2 | 274 | 483 | 9.0E-13 |
| sp|Q29473|CP2DF_CANLF | Cytochrome P450 2D15 OS=Canis lupus familiaris GN=CYP2D15 PE=1 SV=3 | 289 | 483 | 9.0E-13 |
| sp|Q55BU9|C5133_DICDI | Probable cytochrome P450 513A3 OS=Dictyostelium discoideum GN=cyp513A3 PE=3 SV=1 | 275 | 483 | 1.0E-12 |
| sp|Q05556|CP2AB_RABIT | Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 | 289 | 488 | 1.0E-12 |
| sp|Q9VRB3|CP6V1_DROME | Probable cytochrome P450 6v1 OS=Drosophila melanogaster GN=Cyp6v1 PE=2 SV=1 | 274 | 472 | 1.0E-12 |
| sp|Q5QQX7|CP19A_CANLF | Aromatase OS=Canis lupus familiaris GN=CYP19A1 PE=2 SV=1 | 252 | 491 | 1.0E-12 |
| sp|P15392|CP2A4_MOUSE | Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 | 289 | 484 | 1.0E-12 |
| sp|Q91X77|CY250_MOUSE | Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 | 266 | 486 | 1.0E-12 |
| sp|S4UX02|CYPH1_SALMI | Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 | 274 | 487 | 1.0E-12 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005506 | iron ion binding | Yes |
| GO:0004497 | monooxygenase activity | Yes |
| GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | Yes |
| GO:0020037 | heme binding | Yes |
| GO:0046914 | transition metal ion binding | No |
| GO:0046872 | metal ion binding | No |
| GO:0005488 | binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0016491 | oxidoreductase activity | No |
| GO:0003824 | catalytic activity | No |
| GO:0046906 | tetrapyrrole binding | No |
| GO:0003674 | molecular_function | No |
| GO:0043169 | cation binding | No |
| GO:0043167 | ion binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 11 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 7 | 29 | 22 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophio5|1272 MAVIEQVLSWWTIPLLLIAWYGHSYFISYRHLRNIPAPFGAQVTNLWLFIVCRLKARSLYVDRAHQRLGKIVRIQ PNHISIADESAVAVIYGHGNGFLKSDFYDAFISIRPSVFTTRDRVHHSRKRKLVAHAFATRTVLEFEAYVHRILE LFVERMDQLIETSPDRNQAGKPEARVDCFRWLNYLAFDIIGDLTFGAPFGMLQRGADEVETRETPDGPPSYISAV DVLGRRGEVNGVLGCLPWLRSYGRYLPDPFFRRGIDAVNQIAGVAVARVRERLESGPGEKRRDFLARLIEGRDNT GEPLDREEVAAEATAYLVAGSDTTSTTLCAVINSLARHPEILGKLQAELDEAIPEHVAVPRAEDIQDVQYLNWVI DESLRHHTTLGVGLPRLIPSDSPGVTILGRHFRPGTVLSVPAYSLHHDREIWGDDVDEFKPERWESATPRQKKAF IPFSYGPRACVGRNLAEMELRLITATWARRYSFQPMDAEAVLVIKEGFLRKPGRVDVTLSRRR |
| Coding | >Ophio5|1272 ATGGCCGTGATTGAACAAGTCTTGTCTTGGTGGACCATCCCCCTCCTCCTCATCGCGTGGTACGGCCACTCGTAT TTCATCTCCTATCGTCATCTGCGGAATATCCCCGCCCCTTTCGGAGCACAGGTGACCAACCTCTGGCTCTTCATC GTCTGCCGACTCAAGGCTCGCTCTCTCTACGTAGACCGGGCTCATCAGAGGTTGGGCAAGATTGTGCGGATACAG CCCAACCACATCAGCATAGCCGACGAAAGCGCCGTCGCCGTTATTTACGGCCACGGGAACGGCTTTCTCAAGTCA GATTTCTACGATGCCTTCATCTCCATCCGGCCCAGCGTCTTCACCACGCGTGATCGAGTCCATCATTCTCGCAAA CGCAAGCTTGTCGCTCACGCGTTCGCGACGAGGACGGTGCTCGAGTTCGAAGCCTACGTACACCGGATCCTGGAG CTGTTTGTCGAAAGGATGGATCAGCTGATCGAGACGAGCCCGGATCGCAACCAAGCAGGGAAGCCAGAGGCCCGA GTCGACTGCTTTCGCTGGCTCAACTACCTGGCCTTTGACATCATCGGCGACCTGACCTTTGGTGCCCCTTTCGGC ATGCTCCAACGAGGCGCCGACGAGGTGGAGACGAGAGAGACGCCGGATGGCCCGCCCTCGTACATATCGGCAGTC GATGTACTCGGTCGCCGCGGCGAAGTGAATGGAGTGCTCGGCTGCCTTCCATGGCTCAGGTCGTACGGCCGCTAC CTACCAGATCCTTTCTTCCGACGGGGAATCGATGCCGTCAACCAGATCGCGGGAGTAGCCGTAGCCCGCGTTCGG GAAAGACTTGAGAGCGGGCCCGGCGAGAAGCGAAGGGACTTTCTCGCCCGTCTGATTGAAGGTCGCGACAATACA GGGGAGCCGCTGGATCGAGAGGAGGTGGCGGCGGAGGCCACGGCTTATCTGGTTGCTGGCAGCGATACGACGTCC ACGACCTTGTGTGCCGTCATAAACAGCCTCGCCCGTCATCCCGAGATCCTTGGGAAGCTCCAAGCGGAGCTCGAC GAGGCCATACCTGAGCATGTGGCAGTGCCCCGTGCCGAGGATATCCAAGATGTACAATACCTAAACTGGGTCATC GACGAGAGCCTGCGGCACCATACCACCCTGGGCGTAGGCCTGCCGCGCCTAATCCCGTCCGACTCGCCGGGGGTG ACGATTCTGGGACGACATTTCCGCCCGGGCACCGTCCTGAGCGTGCCGGCCTACAGCCTTCACCACGACCGGGAG ATATGGGGCGACGACGTGGACGAGTTCAAGCCCGAGCGGTGGGAGTCGGCCACGCCGCGGCAGAAGAAGGCCTTC ATCCCCTTTAGCTACGGGCCGCGCGCGTGCGTGGGGCGGAACCTGGCCGAGATGGAACTCAGGCTGATCACGGCC ACTTGGGCGAGGAGGTACTCGTTTCAGCCGATGGATGCCGAGGCCGTACTCGTCATCAAGGAGGGGTTCTTGAGG AAGCCGGGGCGGGTGGATGTGACACTGAGTCGAAGAAGA |
| Transcript | >Ophio5|1272 ATGGCCGTGATTGAACAAGTCTTGTCTTGGTGGACCATCCCCCTCCTCCTCATCGCGTGGTACGGCCACTCGTAT TTCATCTCCTATCGTCATCTGCGGAATATCCCCGCCCCTTTCGGAGCACAGGTGACCAACCTCTGGCTCTTCATC GTCTGCCGACTCAAGGCTCGCTCTCTCTACGTAGACCGGGCTCATCAGAGGTTGGGCAAGATTGTGCGGATACAG CCCAACCACATCAGCATAGCCGACGAAAGCGCCGTCGCCGTTATTTACGGCCACGGGAACGGCTTTCTCAAGTCA GATTTCTACGATGCCTTCATCTCCATCCGGCCCAGCGTCTTCACCACGCGTGATCGAGTCCATCATTCTCGCAAA CGCAAGCTTGTCGCTCACGCGTTCGCGACGAGGACGGTGCTCGAGTTCGAAGCCTACGTACACCGGATCCTGGAG CTGTTTGTCGAAAGGATGGATCAGCTGATCGAGACGAGCCCGGATCGCAACCAAGCAGGGAAGCCAGAGGCCCGA GTCGACTGCTTTCGCTGGCTCAACTACCTGGCCTTTGACATCATCGGCGACCTGACCTTTGGTGCCCCTTTCGGC ATGCTCCAACGAGGCGCCGACGAGGTGGAGACGAGAGAGACGCCGGATGGCCCGCCCTCGTACATATCGGCAGTC GATGTACTCGGTCGCCGCGGCGAAGTGAATGGAGTGCTCGGCTGCCTTCCATGGCTCAGGTCGTACGGCCGCTAC CTACCAGATCCTTTCTTCCGACGGGGAATCGATGCCGTCAACCAGATCGCGGGAGTAGCCGTAGCCCGCGTTCGG GAAAGACTTGAGAGCGGGCCCGGCGAGAAGCGAAGGGACTTTCTCGCCCGTCTGATTGAAGGTCGCGACAATACA GGGGAGCCGCTGGATCGAGAGGAGGTGGCGGCGGAGGCCACGGCTTATCTGGTTGCTGGCAGCGATACGACGTCC ACGACCTTGTGTGCCGTCATAAACAGCCTCGCCCGTCATCCCGAGATCCTTGGGAAGCTCCAAGCGGAGCTCGAC GAGGCCATACCTGAGCATGTGGCAGTGCCCCGTGCCGAGGATATCCAAGATGTACAATACCTAAACTGGGTCATC GACGAGAGCCTGCGGCACCATACCACCCTGGGCGTAGGCCTGCCGCGCCTAATCCCGTCCGACTCGCCGGGGGTG ACGATTCTGGGACGACATTTCCGCCCGGGCACCGTCCTGAGCGTGCCGGCCTACAGCCTTCACCACGACCGGGAG ATATGGGGCGACGACGTGGACGAGTTCAAGCCCGAGCGGTGGGAGTCGGCCACGCCGCGGCAGAAGAAGGCCTTC ATCCCCTTTAGCTACGGGCCGCGCGCGTGCGTGGGGCGGAACCTGGCCGAGATGGAACTCAGGCTGATCACGGCC ACTTGGGCGAGGAGGTACTCGTTTCAGCCGATGGATGCCGAGGCCGTACTCGTCATCAAGGAGGGGTTCTTGAGG AAGCCGGGGCGGGTGGATGTGACACTGAGTCGAAGAAGATGA |
| Gene | >Ophio5|1272 ATGGCCGTGATTGAACAAGTCTTGTCTTGGTGGACCATCCCCCTCCTCCTCATCGCGTGGTACGGCCACTCGTAT TTCATCTCCTATCGTCATCTGCGGAATATCCCCGCCCCTTTCGGAGCACAGGTGACCAACCTCTGGCTCTTCATC GTCTGCCGACTCAAGGCTCGCTCTCTCTACGTAGACCGGGCTCATCAGAGGTTGGGCAAGATTGTGCGGATACAG CCCAACCACATCAGCATAGCCGACGAAAGCGCCGTCGCCGTTATTTACGGCCACGGGAACGGCTTTCTCAAGTCG TGGGTGCCATCTTGAGCCCTTTTTCGACCGAGACTTGAGCGCTTACAGTTAGCTGATGGGTGTCCAGAGATTTCT ACGATGCCTTCATCTCCATCCGGCCCAGCGTCTTCACCACGCGTGATCGAGTCCATCATTCTCGCAAACGCAAGC TTGTCGCTCACGCGTTCGCGACGAGGACGGTGCTCGAGTTCGAAGCCTACGTACACCGGATCCTGGAGCTGTTTG TCGAAAGGATGGATCAGCTGATCGAGACGAGCCCGGATCGCAACCAAGCAGGGAAGCCAGAGGCCCGAGTCGACT GCTTTCGCTGGCTCAACTACCTGGCCTTTGACATCATCGGCGACCTGACCTTTGGTGCCCCTTTCGGCATGCTCC AACGAGGCGCCGACGAGGTGGAGACGAGAGAGACGCCGGATGGCCCGCCCTCGTACATATCGGCAGTCGATGTAC TCGGTCGCCGCGGCGAAGTGAATGGAGTGCTCGGCTGCCTTCCATGGCTCAGGTCGTACGGCCGCTACCTACCAG ATCCTTTCTTCCGACGGGGAATCGATGCCGTCAACCAGATCGCGGGAGTAGCCGTAGCCCGCGTTCGGGAAAGAC TTGAGAGCGGGCCCGGCGAGAAGCGAAGGGACTTTCTCGCCCGTCTGATTGAAGGTCGCGACAATACAGGGGAGC CGCTGGATCGAGAGGAGGTGGCGGCGGAGGCCACGGCTTATCTGGTTGCTGGCAGCGATACGACGTCCACGACCT TGTGTGCCGTCATAAACAGCCTCGCCCGTCATCCCGAGATCCTTGGGAAGCTCCAAGCGGAGCTCGACGAGGCCA TACCTGAGCATGTGGCAGTGCCCCGTGCCGAGGATATCCAAGATGTACAATACCTAAACTGGGTCATCGACGAGA GCCTGCGGCACCATACCACCCTGGGCGTAGGCCTGCCGCGCCTAATCCCGTCCGACTCGCCGGGGGTGACGATTC TGGGACGACATTTCCGCCCGGGCACCGTCCTGAGCGTGCCGGCCTACAGCCTTCACCACGACCGGGAGATATGGG GCGACGACGTGGACGAGTTCAAGCCCGAGCGGTGGGAGTCGGCCACGCCGCGGCAGAAGAAGGCCTTCATCCCCT TTAGCTACGGGCCGCGCGCGTGCGTGGGGCGGAACCTGGCCGAGATGGAACTCAGGCTGATCACGGCCACTTGGG CGAGGAGGTACTCGTTTCAGCCGATGGATGCCGAGGCCGTACTCGTCATCAAGGAGGGGTTCTTGAGGAAGCCGG GGCGGGTGGATGTGACACTGAGTCGAAGAAGATGA |