Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1267
Gene name
Locationscaffold_141:261..1323
Strand+
Gene length (bp)1062
Transcript length (bp)1062
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 6.7E-47 2 302

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 2 352 3.0E-37
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 2 352 3.0E-37
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 2 352 3.0E-36
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 2 349 3.0E-36
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 2 344 8.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 2 352 3.0E-37
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 2 352 3.0E-37
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 2 352 3.0E-36
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 2 349 3.0E-36
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 2 344 8.0E-36
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 2 344 9.0E-35
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 2 337 7.0E-34
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 2 327 1.0E-33
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 2 344 1.0E-33
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 2 344 2.0E-32
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 2 344 9.0E-29
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 2 342 9.0E-28
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 4 305 1.0E-18
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 14 327 1.0E-18
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 14 335 2.0E-18
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 6 300 2.0E-18
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 4 300 7.0E-18
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 4 301 8.0E-18
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 3 323 2.0E-17
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 4 300 2.0E-17
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 4 300 2.0E-17
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 4 347 3.0E-17
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 7 300 4.0E-17
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 6 300 4.0E-17
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 5 327 5.0E-17
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 6 300 5.0E-17
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 6 300 5.0E-17
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 6 300 7.0E-17
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 6 300 7.0E-17
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 14 303 1.0E-16
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 14 327 1.0E-16
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 10 303 2.0E-16
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 10 300 5.0E-16
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 10 300 5.0E-16
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 14 303 5.0E-16
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 5 303 1.0E-15
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 6 300 1.0E-15
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 14 327 1.0E-15
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 5 333 1.0E-15
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 3 305 1.0E-15
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 6 300 1.0E-15
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 14 327 2.0E-15
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 6 300 3.0E-15
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 5 337 3.0E-15
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 14 302 4.0E-15
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 14 327 5.0E-15
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 6 300 6.0E-15
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 7 300 7.0E-15
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 4 347 8.0E-15
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 4 347 1.0E-14
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 4 333 2.0E-14
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 14 303 2.0E-14
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 10 299 4.0E-14
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 4 333 5.0E-14
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 14 303 6.0E-14
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 14 237 7.0E-14
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 4 307 1.0E-13
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 4 303 2.0E-13
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 7 300 2.0E-13
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 10 302 3.0E-13
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 14 306 3.0E-13
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 6 299 3.0E-13
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 14 321 3.0E-13
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 14 303 7.0E-13
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 14 303 7.0E-13
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 14 306 7.0E-13
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 3 347 7.0E-13
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 14 300 8.0E-13
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 14 306 9.0E-13
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 2 331 9.0E-13
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 14 299 1.0E-12
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 6 300 1.0E-12
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 14 306 2.0E-12
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 14 306 2.0E-12
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 9 307 3.0E-12
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 14 300 4.0E-12
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 9 298 4.0E-12
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 14 300 5.0E-12
sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=1 SV=3 4 303 6.0E-12
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 14 306 6.0E-12
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 1 307 7.0E-12
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 84 303 8.0E-12
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 14 322 9.0E-12
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 14 236 1.0E-11
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 93 300 1.0E-11
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 14 303 2.0E-11
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 1 302 2.0E-11
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 93 300 3.0E-11
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 14 299 3.0E-11
sp|Q9JIF3|GTR8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus GN=Slc2a8 PE=1 SV=2 4 303 3.0E-11
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 14 300 4.0E-11
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 14 307 4.0E-11
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 3 303 5.0E-11
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 14 336 5.0E-11
sp|Q9JJZ1|GTR8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus GN=Slc2a8 PE=1 SV=1 4 303 5.0E-11
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 14 303 5.0E-11
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 1 343 6.0E-11
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 1 306 7.0E-11
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 2 322 8.0E-11
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 83 307 8.0E-11
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 14 302 1.0E-10
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 93 299 1.0E-10
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 93 299 2.0E-10
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 83 307 2.0E-10
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 14 237 2.0E-10
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 14 304 3.0E-10
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 14 302 3.0E-10
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 3 331 4.0E-10
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 83 307 5.0E-10
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 14 322 7.0E-10
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 8 335 1.0E-09
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 14 303 2.0E-09
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 2 299 2.0E-09
sp|P58354|GTR8_BOVIN Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2 4 303 2.0E-09
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 4 301 2.0E-09
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 14 303 3.0E-09
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 4 298 3.0E-09
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 14 303 3.0E-09
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 10 302 3.0E-09
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 2 303 4.0E-09
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 83 307 4.0E-09
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 14 335 5.0E-09
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 14 335 6.0E-09
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 14 303 6.0E-09
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 2 165 7.0E-09
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 5 303 1.0E-08
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 10 299 1.0E-08
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 14 321 1.0E-08
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 2 300 1.0E-08
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 14 303 2.0E-08
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 4 302 4.0E-08
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 3 330 4.0E-08
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 52 318 6.0E-08
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 10 299 6.0E-08
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 14 230 6.0E-08
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 81 299 6.0E-08
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 10 299 7.0E-08
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 76 302 8.0E-08
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 8 338 9.0E-08
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 10 299 1.0E-07
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 8 302 1.0E-07
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 6 352 1.0E-07
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 4 352 2.0E-07
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 90 307 3.0E-07
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 9 300 3.0E-07
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 1 319 1.0E-06
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 11 299 2.0E-06
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 10 303 2.0E-06
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 91 304 2.0E-06
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 14 301 3.0E-06
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 14 230 3.0E-06
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 15 184 3.0E-06
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 13 299 3.0E-06
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 2 303 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 123 145 22
2 154 176 22
3 263 285 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1267
MAGIIFLLSFLQLESPRFLVKQRRPHDAADVMAHLRRQPVDGPYVTAEIARIQEALDRELEATQGVGWLGQVKDM
FLDSGNLYRLYLTTMVQLLSQWSGAGSITLYAPDLFKILGIVGSEEGLLVTAVFGIVKLVAALVCALFLVDVIGR
KRSLLVGIALQAVSSLYVASFLTAVPQLGVDDNFVVPAAVKGASRGAIAMIYISGCGWALGWNSMQYLLTAELFP
LRIRALATSWAMTLHFANQYGNSRAVPVMLLPVSKGGISPSGTFWCFAAVTLLGAFWVWFSVPETGGRSLESMDR
LFELPWYEIGLRGNRHAEKQDLAHREKEKEEHSVEDESVIKSQQLGKMETIDF
Coding >Ophio5|1267
ATGGCCGGCATCATCTTCCTGCTCAGCTTCCTGCAGCTCGAGTCGCCGCGCTTCCTCGTCAAGCAGCGGCGACCC
CATGATGCGGCCGACGTCATGGCTCATCTGCGCCGGCAGCCCGTCGACGGCCCCTACGTCACCGCCGAGATCGCC
CGCATCCAGGAGGCCCTCGACCGCGAGCTCGAGGCGACCCAAGGTGTAGGATGGCTCGGTCAGGTCAAGGACATG
TTTCTCGACTCCGGCAACCTGTACCGGCTCTATCTGACGACCATGGTTCAGCTGCTGTCGCAGTGGTCCGGCGCC
GGTTCCATCACGCTCTACGCCCCGGATCTGTTCAAGATCCTCGGCATCGTCGGCAGTGAGGAGGGCCTTCTCGTC
ACCGCCGTCTTTGGCATCGTAAAGCTCGTCGCCGCCCTCGTCTGCGCCCTCTTCCTCGTCGATGTCATCGGCCGC
AAGCGCTCTCTGCTCGTCGGAATCGCTCTCCAGGCCGTCTCCTCCCTATACGTTGCCTCCTTCTTAACGGCCGTG
CCCCAGCTGGGCGTCGACGACAACTTCGTCGTGCCTGCTGCCGTAAAGGGTGCCAGTCGTGGCGCCATCGCCATG
ATCTACATCTCTGGCTGTGGCTGGGCCCTGGGATGGAACTCGATGCAGTACCTACTGACGGCCGAGCTCTTCCCG
CTGCGGATCCGTGCCCTGGCCACGTCGTGGGCCATGACACTGCACTTTGCCAACCAGTACGGCAACTCACGCGCC
GTGCCCGTCATGCTGCTGCCCGTCTCCAAGGGCGGCATCTCTCCGAGCGGCACCTTTTGGTGCTTCGCCGCCGTC
ACTCTTCTCGGCGCCTTCTGGGTCTGGTTCTCCGTCCCCGAGACGGGTGGCCGCAGCCTCGAAAGCATGGACCGC
CTGTTCGAGCTGCCGTGGTACGAGATCGGCCTCCGCGGCAACCGACACGCCGAGAAGCAGGACCTGGCCCACCGC
GAGAAGGAGAAGGAGGAACACAGTGTCGAGGACGAGTCCGTCATCAAGTCGCAGCAACTGGGAAAGATGGAGACG
ATCGACTTC
Transcript >Ophio5|1267
ATGGCCGGCATCATCTTCCTGCTCAGCTTCCTGCAGCTCGAGTCGCCGCGCTTCCTCGTCAAGCAGCGGCGACCC
CATGATGCGGCCGACGTCATGGCTCATCTGCGCCGGCAGCCCGTCGACGGCCCCTACGTCACCGCCGAGATCGCC
CGCATCCAGGAGGCCCTCGACCGCGAGCTCGAGGCGACCCAAGGTGTAGGATGGCTCGGTCAGGTCAAGGACATG
TTTCTCGACTCCGGCAACCTGTACCGGCTCTATCTGACGACCATGGTTCAGCTGCTGTCGCAGTGGTCCGGCGCC
GGTTCCATCACGCTCTACGCCCCGGATCTGTTCAAGATCCTCGGCATCGTCGGCAGTGAGGAGGGCCTTCTCGTC
ACCGCCGTCTTTGGCATCGTAAAGCTCGTCGCCGCCCTCGTCTGCGCCCTCTTCCTCGTCGATGTCATCGGCCGC
AAGCGCTCTCTGCTCGTCGGAATCGCTCTCCAGGCCGTCTCCTCCCTATACGTTGCCTCCTTCTTAACGGCCGTG
CCCCAGCTGGGCGTCGACGACAACTTCGTCGTGCCTGCTGCCGTAAAGGGTGCCAGTCGTGGCGCCATCGCCATG
ATCTACATCTCTGGCTGTGGCTGGGCCCTGGGATGGAACTCGATGCAGTACCTACTGACGGCCGAGCTCTTCCCG
CTGCGGATCCGTGCCCTGGCCACGTCGTGGGCCATGACACTGCACTTTGCCAACCAGTACGGCAACTCACGCGCC
GTGCCCGTCATGCTGCTGCCCGTCTCCAAGGGCGGCATCTCTCCGAGCGGCACCTTTTGGTGCTTCGCCGCCGTC
ACTCTTCTCGGCGCCTTCTGGGTCTGGTTCTCCGTCCCCGAGACGGGTGGCCGCAGCCTCGAAAGCATGGACCGC
CTGTTCGAGCTGCCGTGGTACGAGATCGGCCTCCGCGGCAACCGACACGCCGAGAAGCAGGACCTGGCCCACCGC
GAGAAGGAGAAGGAGGAACACAGTGTCGAGGACGAGTCCGTCATCAAGTCGCAGCAACTGGGAAAGATGGAGACG
ATCGACTTCTGA
Gene >Ophio5|1267
ATGGCCGGCATCATCTTCCTGCTCAGCTTCCTGCAGCTCGAGTCGCCGCGCTTCCTCGTCAAGCAGCGGCGACCC
CATGATGCGGCCGACGTCATGGCTCATCTGCGCCGGCAGCCCGTCGACGGCCCCTACGTCACCGCCGAGATCGCC
CGCATCCAGGAGGCCCTCGACCGCGAGCTCGAGGCGACCCAAGGTGTAGGATGGCTCGGTCAGGTCAAGGACATG
TTTCTCGACTCCGGCAACCTGTACCGGCTCTATCTGACGACCATGGTTCAGCTGCTGTCGCAGTGGTCCGGCGCC
GGTTCCATCACGCTCTACGCCCCGGATCTGTTCAAGATCCTCGGCATCGTCGGCAGTGAGGAGGGCCTTCTCGTC
ACCGCCGTCTTTGGCATCGTAAAGCTCGTCGCCGCCCTCGTCTGCGCCCTCTTCCTCGTCGATGTCATCGGCCGC
AAGCGCTCTCTGCTCGTCGGAATCGCTCTCCAGGCCGTCTCCTCCCTATACGTTGCCTCCTTCTTAACGGCCGTG
CCCCAGCTGGGCGTCGACGACAACTTCGTCGTGCCTGCTGCCGTAAAGGGTGCCAGTCGTGGCGCCATCGCCATG
ATCTACATCTCTGGCTGTGGCTGGGCCCTGGGATGGAACTCGATGCAGTACCTACTGACGGCCGAGCTCTTCCCG
CTGCGGATCCGTGCCCTGGCCACGTCGTGGGCCATGACACTGCACTTTGCCAACCAGTACGGCAACTCACGCGCC
GTGCCCGTCATGCTGCTGCCCGTCTCCAAGGGCGGCATCTCTCCGAGCGGCACCTTTTGGTGCTTCGCCGCCGTC
ACTCTTCTCGGCGCCTTCTGGGTCTGGTTCTCCGTCCCCGAGACGGGTGGCCGCAGCCTCGAAAGCATGGACCGC
CTGTTCGAGCTGCCGTGGTACGAGATCGGCCTCCGCGGCAACCGACACGCCGAGAAGCAGGACCTGGCCCACCGC
GAGAAGGAGAAGGAGGAACACAGTGTCGAGGACGAGTCCGTCATCAAGTCGCAGCAACTGGGAAAGATGGAGACG
ATCGACTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail