Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1262
Gene name
Locationscaffold_1401:140..1754
Strand+
Gene length (bp)1614
Transcript length (bp)1614
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 9.4E-05 13 309

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UUH0|YKIC_SCHPO Uncharacterized protein C630.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC630.12 PE=3 SV=1 1 399 2.0E-34
sp|P40986|CDC1_YEAST Cell division control protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC1 PE=1 SV=2 2 381 2.0E-22
sp|Q5ZK82|MPPE1_CHICK Metallophosphoesterase 1 OS=Gallus gallus GN=MPPE1 PE=2 SV=1 1 400 2.0E-09

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 377 399 22
2 511 533 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1262
MRRGYLALQGRLHPDSLFFLGDLFDGGREWKTHQGRFVDPHWGIRRPEREQKRLAKWHRKYGEKYWLGEYRRFSD
IFFRPWNVGGAAPGPWQRGRKLVASLPGNHDLGFGAQVQVPVRDRFGAFFGDVNRVDVVGNHTIVSVDTVSLSAD
SSKYKDGHDLRPIYGPVHDFLDHVQTAKRKAARDELDVWYGVDRGQRFAHAVEDLNGADLSRFPAADDGAGGPDW
PTILLTHVPLYREPGTPCGPRRERWPPTKPRRGQTGPVVPDHGNAISVAAGYQYQNVLSEEDSLRLVGSVGNITH
VFSGDDHDYCELVHGEARGRVRETTVKSFSMAMGVSTPGFVMASLWNPVGADGKPIPGSPPTTMQTHLCLMPNQL
RTYAMYAALAALSLVILSARALLMPVLRLTPFALEPETTTTTTTTVLLPVRSATGKAKAEPPVRRPAASATTATE
RNGSSRWSSRKGRRWTGVDYDYYYDDDYYHKSGPRITLDRDFYDGGKAWKRARNRTALGTIWRELWTTVWRVAWM
TGLVWLYLAMKG
Coding >Ophio5|1262
ATGCGGCGCGGCTACCTCGCCCTGCAAGGCCGCCTGCACCCGGACAGCCTCTTCTTCCTCGGCGACCTCTTCGAC
GGCGGTCGGGAGTGGAAGACGCATCAGGGCCGATTCGTCGACCCGCACTGGGGCATCCGACGTCCGGAACGGGAG
CAGAAGCGGCTGGCCAAGTGGCACCGCAAGTATGGCGAGAAGTACTGGCTGGGCGAATACCGCCGCTTCAGTGAC
ATCTTCTTCCGACCCTGGAACGTCGGCGGCGCGGCTCCTGGTCCGTGGCAGAGGGGCCGCAAGCTCGTCGCCAGC
CTGCCGGGAAACCATGACTTGGGCTTCGGCGCCCAGGTTCAGGTGCCGGTGCGTGACCGGTTCGGCGCCTTCTTC
GGCGATGTCAACCGCGTCGACGTCGTCGGCAACCACACCATCGTCTCCGTCGACACTGTTTCTCTCAGCGCCGAC
TCGTCCAAGTATAAGGACGGTCACGACCTGAGACCCATCTACGGGCCCGTCCACGACTTCCTCGATCATGTTCAG
ACGGCCAAGCGGAAGGCGGCGCGGGACGAGCTGGACGTCTGGTACGGCGTCGACCGCGGCCAGCGCTTCGCCCAT
GCCGTCGAGGACTTGAACGGCGCCGACCTGAGCCGATTCCCGGCCGCCGACGACGGAGCCGGCGGGCCGGACTGG
CCGACCATCCTCCTCACACACGTACCGCTCTACCGCGAGCCGGGTACGCCGTGCGGTCCGCGACGCGAGCGTTGG
CCGCCGACGAAGCCGCGGCGAGGCCAGACGGGGCCCGTGGTGCCGGATCACGGCAACGCCATCTCGGTCGCGGCC
GGATACCAGTATCAGAACGTGCTGAGCGAGGAGGACTCGCTTCGGTTGGTCGGCAGCGTCGGAAACATCACCCAC
GTCTTCTCCGGCGACGACCACGACTACTGCGAGCTGGTGCACGGCGAGGCCCGGGGCCGGGTGCGGGAGACGACG
GTCAAGAGCTTCAGTATGGCCATGGGCGTGTCGACGCCGGGGTTCGTCATGGCGAGCCTATGGAACCCTGTGGGC
GCCGACGGGAAGCCGATTCCGGGTTCGCCGCCGACGACGATGCAGACGCACCTCTGCCTGATGCCCAACCAGCTA
AGGACGTACGCCATGTACGCGGCCCTGGCGGCCCTGTCGCTGGTCATCTTGTCGGCGAGGGCGCTGTTGATGCCG
GTCCTACGACTGACGCCGTTTGCGCTTGAGCCGGAAACGACGACGACGACGACGACGACGGTGCTGCTGCCCGTC
CGCTCGGCCACGGGAAAGGCCAAAGCGGAGCCTCCGGTGCGAAGGCCGGCGGCGTCGGCGACGACGGCGACCGAA
CGAAACGGCTCATCTCGGTGGTCCTCTCGCAAGGGTCGACGCTGGACGGGCGTCGACTACGACTACTACTACGAC
GACGACTACTACCACAAGTCCGGGCCGCGCATCACACTGGACCGCGACTTTTACGACGGGGGCAAGGCTTGGAAG
CGGGCTCGTAATAGGACGGCGCTGGGAACGATTTGGAGGGAGCTTTGGACTACGGTTTGGAGGGTGGCTTGGATG
ACGGGTTTGGTGTGGCTGTATCTGGCTATGAAGGGG
Transcript >Ophio5|1262
ATGCGGCGCGGCTACCTCGCCCTGCAAGGCCGCCTGCACCCGGACAGCCTCTTCTTCCTCGGCGACCTCTTCGAC
GGCGGTCGGGAGTGGAAGACGCATCAGGGCCGATTCGTCGACCCGCACTGGGGCATCCGACGTCCGGAACGGGAG
CAGAAGCGGCTGGCCAAGTGGCACCGCAAGTATGGCGAGAAGTACTGGCTGGGCGAATACCGCCGCTTCAGTGAC
ATCTTCTTCCGACCCTGGAACGTCGGCGGCGCGGCTCCTGGTCCGTGGCAGAGGGGCCGCAAGCTCGTCGCCAGC
CTGCCGGGAAACCATGACTTGGGCTTCGGCGCCCAGGTTCAGGTGCCGGTGCGTGACCGGTTCGGCGCCTTCTTC
GGCGATGTCAACCGCGTCGACGTCGTCGGCAACCACACCATCGTCTCCGTCGACACTGTTTCTCTCAGCGCCGAC
TCGTCCAAGTATAAGGACGGTCACGACCTGAGACCCATCTACGGGCCCGTCCACGACTTCCTCGATCATGTTCAG
ACGGCCAAGCGGAAGGCGGCGCGGGACGAGCTGGACGTCTGGTACGGCGTCGACCGCGGCCAGCGCTTCGCCCAT
GCCGTCGAGGACTTGAACGGCGCCGACCTGAGCCGATTCCCGGCCGCCGACGACGGAGCCGGCGGGCCGGACTGG
CCGACCATCCTCCTCACACACGTACCGCTCTACCGCGAGCCGGGTACGCCGTGCGGTCCGCGACGCGAGCGTTGG
CCGCCGACGAAGCCGCGGCGAGGCCAGACGGGGCCCGTGGTGCCGGATCACGGCAACGCCATCTCGGTCGCGGCC
GGATACCAGTATCAGAACGTGCTGAGCGAGGAGGACTCGCTTCGGTTGGTCGGCAGCGTCGGAAACATCACCCAC
GTCTTCTCCGGCGACGACCACGACTACTGCGAGCTGGTGCACGGCGAGGCCCGGGGCCGGGTGCGGGAGACGACG
GTCAAGAGCTTCAGTATGGCCATGGGCGTGTCGACGCCGGGGTTCGTCATGGCGAGCCTATGGAACCCTGTGGGC
GCCGACGGGAAGCCGATTCCGGGTTCGCCGCCGACGACGATGCAGACGCACCTCTGCCTGATGCCCAACCAGCTA
AGGACGTACGCCATGTACGCGGCCCTGGCGGCCCTGTCGCTGGTCATCTTGTCGGCGAGGGCGCTGTTGATGCCG
GTCCTACGACTGACGCCGTTTGCGCTTGAGCCGGAAACGACGACGACGACGACGACGACGGTGCTGCTGCCCGTC
CGCTCGGCCACGGGAAAGGCCAAAGCGGAGCCTCCGGTGCGAAGGCCGGCGGCGTCGGCGACGACGGCGACCGAA
CGAAACGGCTCATCTCGGTGGTCCTCTCGCAAGGGTCGACGCTGGACGGGCGTCGACTACGACTACTACTACGAC
GACGACTACTACCACAAGTCCGGGCCGCGCATCACACTGGACCGCGACTTTTACGACGGGGGCAAGGCTTGGAAG
CGGGCTCGTAATAGGACGGCGCTGGGAACGATTTGGAGGGAGCTTTGGACTACGGTTTGGAGGGTGGCTTGGATG
ACGGGTTTGGTGTGGCTGTATCTGGCTATGAAGGGGTAG
Gene >Ophio5|1262
ATGCGGCGCGGCTACCTCGCCCTGCAAGGCCGCCTGCACCCGGACAGCCTCTTCTTCCTCGGCGACCTCTTCGAC
GGCGGTCGGGAGTGGAAGACGCATCAGGGCCGATTCGTCGACCCGCACTGGGGCATCCGACGTCCGGAACGGGAG
CAGAAGCGGCTGGCCAAGTGGCACCGCAAGTATGGCGAGAAGTACTGGCTGGGCGAATACCGCCGCTTCAGTGAC
ATCTTCTTCCGACCCTGGAACGTCGGCGGCGCGGCTCCTGGTCCGTGGCAGAGGGGCCGCAAGCTCGTCGCCAGC
CTGCCGGGAAACCATGACTTGGGCTTCGGCGCCCAGGTTCAGGTGCCGGTGCGTGACCGGTTCGGCGCCTTCTTC
GGCGATGTCAACCGCGTCGACGTCGTCGGCAACCACACCATCGTCTCCGTCGACACTGTTTCTCTCAGCGCCGAC
TCGTCCAAGTATAAGGACGGTCACGACCTGAGACCCATCTACGGGCCCGTCCACGACTTCCTCGATCATGTTCAG
ACGGCCAAGCGGAAGGCGGCGCGGGACGAGCTGGACGTCTGGTACGGCGTCGACCGCGGCCAGCGCTTCGCCCAT
GCCGTCGAGGACTTGAACGGCGCCGACCTGAGCCGATTCCCGGCCGCCGACGACGGAGCCGGCGGGCCGGACTGG
CCGACCATCCTCCTCACACACGTACCGCTCTACCGCGAGCCGGGTACGCCGTGCGGTCCGCGACGCGAGCGTTGG
CCGCCGACGAAGCCGCGGCGAGGCCAGACGGGGCCCGTGGTGCCGGATCACGGCAACGCCATCTCGGTCGCGGCC
GGATACCAGTATCAGAACGTGCTGAGCGAGGAGGACTCGCTTCGGTTGGTCGGCAGCGTCGGAAACATCACCCAC
GTCTTCTCCGGCGACGACCACGACTACTGCGAGCTGGTGCACGGCGAGGCCCGGGGCCGGGTGCGGGAGACGACG
GTCAAGAGCTTCAGTATGGCCATGGGCGTGTCGACGCCGGGGTTCGTCATGGCGAGCCTATGGAACCCTGTGGGC
GCCGACGGGAAGCCGATTCCGGGTTCGCCGCCGACGACGATGCAGACGCACCTCTGCCTGATGCCCAACCAGCTA
AGGACGTACGCCATGTACGCGGCCCTGGCGGCCCTGTCGCTGGTCATCTTGTCGGCGAGGGCGCTGTTGATGCCG
GTCCTACGACTGACGCCGTTTGCGCTTGAGCCGGAAACGACGACGACGACGACGACGACGGTGCTGCTGCCCGTC
CGCTCGGCCACGGGAAAGGCCAAAGCGGAGCCTCCGGTGCGAAGGCCGGCGGCGTCGGCGACGACGGCGACCGAA
CGAAACGGCTCATCTCGGTGGTCCTCTCGCAAGGGTCGACGCTGGACGGGCGTCGACTACGACTACTACTACGAC
GACGACTACTACCACAAGTCCGGGCCGCGCATCACACTGGACCGCGACTTTTACGACGGGGGCAAGGCTTGGAAG
CGGGCTCGTAATAGGACGGCGCTGGGAACGATTTGGAGGGAGCTTTGGACTACGGTTTGGAGGGTGGCTTGGATG
ACGGGTTTGGTGTGGCTGTATCTGGCTATGAAGGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail