Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1260
Gene name
Locationscaffold_140:37301..38346
Strand-
Gene length (bp)1045
Transcript length (bp)921
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04991 LicD LicD family 8.8E-15 104 203

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36044|MNN4_YEAST Protein MNN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNN4 PE=4 SV=2 55 246 1.0E-16
sp|P40355|YJ31_YEAST Uncharacterized protein YJR061W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR061W PE=4 SV=2 55 197 1.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1260
MARLSVLPTAMPSLMMLFMILLNLVHQATGSAITHHPTVPSAVPHSHPQPFPSILTPKYFHEPRGSLARSHYDLR
YFVSEVAYEEHGPVLRDLIRSYLSVMTLHGVETWLAHGTLLGWWWNGRVMPWDYDLDVQVSNATLTWMADRLNQT
HHEVDSKIYLLDINPHYDELSRGDGMNIIDARWIDTANGMFIDITALREREPHRPRVWSCKNKHRYETQDLWPMR
LSQFEGVAARVPYNVEKILLDEYGAKCLVVEEHEGHRWDRDVKEWVIIPPEVHEQRRLASAAAAAEAERQRQTSS
IVVEAS
Coding >Ophio5|1260
ATGGCACGGCTCAGCGTCCTTCCCACCGCGATGCCTTCCCTCATGATGCTCTTCATGATACTCCTCAACCTCGTG
CACCAAGCAACCGGCTCAGCGATAACGCACCATCCGACGGTTCCCTCGGCCGTACCGCATTCGCACCCACAACCG
TTCCCATCGATACTGACGCCCAAATACTTTCACGAGCCACGAGGAAGCCTTGCGCGCAGCCATTATGATTTACGC
TACTTTGTTTCCGAAGTCGCCTACGAGGAACACGGTCCTGTTCTTCGCGACTTGATTCGAAGCTATCTCTCCGTC
ATGACTCTTCACGGTGTAGAAACTTGGCTCGCGCATGGGACGTTGCTCGGCTGGTGGTGGAATGGTCGCGTCATG
CCTTGGGATTACGATCTTGATGTTCAGGTCTCGAACGCGACGTTGACATGGATGGCTGATAGGTTGAATCAGACT
CATCACGAGGTTGATTCCAAGATTTACCTATTGGATATCAACCCGCATTATGATGAGCTTTCTCGTGGCGATGGC
ATGAACATCATCGACGCCAGGTGGATCGATACCGCAAACGGTATGTTCATCGACATCACAGCCTTGAGGGAACGC
GAGCCACATCGTCCTCGGGTTTGGAGTTGCAAGAATAAGCACCGCTACGAGACTCAGGATCTGTGGCCCATGCGT
CTGAGCCAATTTGAGGGCGTGGCCGCGCGCGTGCCGTACAACGTCGAGAAGATCTTGCTGGACGAGTACGGCGCC
AAGTGTCTGGTTGTCGAGGAGCACGAGGGGCACCGCTGGGATCGCGACGTCAAGGAATGGGTCATCATCCCTCCC
GAGGTGCACGAACAGCGTCGCCTCGCCTCCGCTGCCGCTGCCGCTGAAGCCGAGCGACAGAGACAGACATCGTCC
ATCGTCGTCGAAGCTTCT
Transcript >Ophio5|1260
ATGGCACGGCTCAGCGTCCTTCCCACCGCGATGCCTTCCCTCATGATGCTCTTCATGATACTCCTCAACCTCGTG
CACCAAGCAACCGGCTCAGCGATAACGCACCATCCGACGGTTCCCTCGGCCGTACCGCATTCGCACCCACAACCG
TTCCCATCGATACTGACGCCCAAATACTTTCACGAGCCACGAGGAAGCCTTGCGCGCAGCCATTATGATTTACGC
TACTTTGTTTCCGAAGTCGCCTACGAGGAACACGGTCCTGTTCTTCGCGACTTGATTCGAAGCTATCTCTCCGTC
ATGACTCTTCACGGTGTAGAAACTTGGCTCGCGCATGGGACGTTGCTCGGCTGGTGGTGGAATGGTCGCGTCATG
CCTTGGGATTACGATCTTGATGTTCAGGTCTCGAACGCGACGTTGACATGGATGGCTGATAGGTTGAATCAGACT
CATCACGAGGTTGATTCCAAGATTTACCTATTGGATATCAACCCGCATTATGATGAGCTTTCTCGTGGCGATGGC
ATGAACATCATCGACGCCAGGTGGATCGATACCGCAAACGGTATGTTCATCGACATCACAGCCTTGAGGGAACGC
GAGCCACATCGTCCTCGGGTTTGGAGTTGCAAGAATAAGCACCGCTACGAGACTCAGGATCTGTGGCCCATGCGT
CTGAGCCAATTTGAGGGCGTGGCCGCGCGCGTGCCGTACAACGTCGAGAAGATCTTGCTGGACGAGTACGGCGCC
AAGTGTCTGGTTGTCGAGGAGCACGAGGGGCACCGCTGGGATCGCGACGTCAAGGAATGGGTCATCATCCCTCCC
GAGGTGCACGAACAGCGTCGCCTCGCCTCCGCTGCCGCTGCCGCTGAAGCCGAGCGACAGAGACAGACATCGTCC
ATCGTCGTCGAAGCTTCTTGA
Gene >Ophio5|1260
ATGGCACGGCTCAGCGTCCTTCCCACCGCGATGCCTTCCCTCATGATGCTCTTCATGATACTCCTCAACCTCGTG
CACCAAGCAACCGGCTCAGCGATAACGCACCATCCGACGGTTCCCTCGGCCGTACCGCATTCGCACCCACAACCG
TTCCCATCGATACTGACGCCCAAATACTTTCACGAGCCACGAGGAAGCCTTGCGCGCAGCCATTATGATTTACGC
TACTTTGTTTCCGAAGTCGCCTACGAGGAACACGGTCCTGTTCTTCGCGACTTGATTCGAAGCTATCTCTCCGTC
ATGACTCTTCACGGTGTAGAAACTTGGCTCGCGCATGGGACGTTGCTCGGCTGGTGGTGGAATGGTCGCGTCATG
CCTTGGGATTACGATCTTGATGTTCAGGTCTCGAACGCGACGTTGACATGGATGGCTGATAGGTTGAATCAGACT
CATCACGAGGTTGATTCCAAGATTTACCTATTGGATATCAACCCGCATTATGATGAGCTTTCTCGTGGCGATGGC
ATGAACATCATCGACGCCAGGTGGATCGATACCGCAAACGGTATGTTCATCGACATCACAGCCTTGAGGGAACGC
GAGCCACATCGTCCTCGGGTTTGGAGTTGCAAGAATAAGCACCGCTACGAGACTCAGGATCTGTGGCCCATGCGT
CTGAGCCAATTTGAGGGCGTGGCCGCGCGCGTGCCGTACAACGTCGAGAAGATCTTGCTGGACGAGTACGGCGCC
AAGTGTCTGGTTGTCGAGGAGCACGAGGGGTGAGTGAACCTTCTCTCTCTTTCTCTCTTTCTCTCTCTCTTTCTC
CCCTCCATTCCAAAGGTCTTTCTGGAGTCTGACCAGATCGTCTTGACAAAAAACAAAAAAAAAACAAAACAAAAA
AAGGCACCGCTGGGATCGCGACGTCAAGGAATGGGTCATCATCCCTCCCGAGGTGCACGAACAGCGTCGCCTCGC
CTCCGCTGCCGCTGCCGCTGAAGCCGAGCGACAGAGACAGACATCGTCCATCGTCGTCGAAGCTTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail