Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1254
Gene name
Locationscaffold_140:20094..24976
Strand+
Gene length (bp)4882
Transcript length (bp)4110
Coding sequence length (bp)4107
Protein length (aa) 1369

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1569 0.1567 0.8896 0.3015 0.0465 0.026 0.2924 0.1675 0.1784 0.0095

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1268
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|299
Ophiocordyceps australis map64 (Brazil) OphauB2|2413
Ophiocordyceps camponoti-floridani Ophcf2|03707
Ophiocordyceps camponoti-rufipedis Ophun1|4177
Ophiocordyceps kimflemingae Ophio5|1254 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10523

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1254
MGPPTARAPNNPNSSTSTSTFMSMSMATRLPAPIRDAVSRRAGVVDALSPETPHATWEQSADGWMRGYVGSVHMP
PHAPCGFNGVFVLGALAAGVVSGWKYPDCEHDNCYRNLIDNRFEHLAPRFCIDFISDLRKDPSEIHQEFRNNCGN
DVGKVSSACSCVAYTATHTTQATTAVIAPSADAQPTDSAPGYGSFRFMPNQRYPSPGGGGGGQSSRLPVLLALAL
PAPPLRTRLNSTDSDGFRESPRDSDSDSDSDDSGEMATSISSPGSPSSVPGYGYPSAPGGDSSSVAPTAPVKRIK
PSLPVLPEASHSGPSFDYPPPQGSSSGAMPSASMPNPMDDSTSLSPGIGSSSMPMTTIGWTTSTVSTTMIYTVTS
CPPQVTHCPGKAHTSLVTETIAISTTVCPVTSTLPASTPASAVPGSSSTSMEPETGSASQPGQSDTASAGQPGTP
AARYPEQPGTASSSQPGSSSSGSLGMPSANYPEQPGSTSLGQSELPSSSQPGLPSPSQPGMSPSSQPGSSSGQAG
MPSASQPARLQVSRDHRLQVSPGRRLLASLICHLPANPPGMPSASPPGIPSASQPGMPSAIYPERPGSTSSSQSG
SPSSGQPGMPSASQPGSSSSTSQPGMPSASQPGMPSAIYPEQPGSTSSSLSGSPSSSQPGMPSASQPGQPETAPA
RYPLQPGTESTSSLGQPTSSQPNQPGTMSSGQPGTASSSQPQPTSWTTSTMHTTRVHTITQCPPQVTNCPYKDRT
TVMTETMAISTTVCPVSPTGQPSQPAGMPSGPGASGSSMPVGTPSGPDTPGSSQSATTPSGSSSSQPPQKPSGSG
APGSSQSPSMPSGPSYSQPAETPSESIAPGSSQPAPTSSSPGYGQPSQKPSGSGAPGSSQSPSMPSGPGYSQPAE
TPSKSIAPGSSQSVSMPSGSSSSQPSGSPSMPGAPGSSQPAMTPSSPGYRQPSQTPPSVPDTPESTQPAQPVGMP
SGPSAPGSSQPAQMPSGPGYGQPVGMPSGPNASGSSQPAKTPSGPSASATMPSGPGYSPPAGMSSGPGAPDSGQP
AMTPPAPGSSQSPSGPGYSQPSDKPSGPDAPDSVPSVSLSMLPASKFLSQSQPTSWTTSTIRTTTVRTITHCPAE
QTKCPSGGHTKVVTETIALSTTVCPVQPTGQPSSGPASSQPGQSSSSGPYPSQSDQPSSGPASSQPGQSSSSGPY
PGQPSSGSASSQSGQSSSGSGPGQTSGSEAPSPPAGTKPSTSAAQYMTQTLSMPSCAPDSSDCVNDSDSTMSYPS
PSTLASKIKSSNRVATGESSTEQSSTAQPQPDDEEEEKPSSTQQEAPQYGSMTPAFGVSASMTTSPAVVTAAAGR
VSGGGVKLVAAVAGMLALL
Coding >Ophio5|1254
ATGGGTCCCCCAACGGCTCGAGCTCCCAACAACCCCAACTCAAGCACAAGCACAAGCACATTTATGTCTATGTCA
ATGGCAACGCGGCTGCCCGCTCCAATCAGGGACGCCGTCAGCCGCCGGGCAGGCGTCGTCGACGCACTTTCTCCG
GAGACACCACACGCAACGTGGGAACAAAGTGCGGATGGATGGATGCGTGGGTATGTGGGCTCCGTGCACATGCCT
CCTCACGCGCCCTGTGGTTTCAACGGCGTCTTCGTCCTGGGCGCTCTAGCCGCTGGCGTCGTCAGCGGCTGGAAA
TACCCTGACTGCGAGCATGACAACTGCTACCGCAACCTCATAGACAACCGCTTCGAGCATCTTGCCCCCAGGTTC
TGCATCGACTTCATCTCCGACCTTAGGAAGGACCCGTCGGAAATTCATCAAGAGTTCCGCAACAACTGTGGGAAC
GATGTGGGAAAAGTCAGCTCCGCCTGCTCGTGTGTCGCCTATACGGCTACCCACACCACTCAAGCCACCACGGCC
GTCATCGCACCCAGCGCGGACGCGCAGCCGACAGACTCGGCACCCGGCTACGGATCTTTCAGATTCATGCCGAAC
CAGAGATACCCGTCTCCGGGCGGCGGTGGCGGCGGCCAGTCTTCTAGACTCCCGGTACTTCTTGCTCTAGCTCTT
CCAGCTCCGCCGCTCCGAACTCGTCTGAACTCTACGGACTCGGACGGCTTCAGAGAAAGCCCTAGGGATTCAGAC
TCGGACTCGGACTCGGACGATTCTGGAGAAATGGCCACATCGATTTCCAGCCCCGGATCTCCAAGCTCTGTCCCT
GGCTACGGCTACCCTTCTGCACCAGGTGGCGATAGCTCGTCAGTCGCCCCAACGGCACCGGTAAAGCGCATCAAG
CCTTCCCTTCCGGTCCTCCCTGAAGCATCTCACTCCGGACCAAGCTTTGACTACCCCCCTCCGCAGGGTTCCAGC
TCTGGAGCCATGCCGTCTGCCTCGATGCCGAACCCGATGGATGACTCGACCTCGCTGTCGCCTGGTATAGGATCC
TCCAGCATGCCCATGACTACAATAGGTTGGACCACGTCGACTGTCAGCACCACAATGATCTACACCGTGACTTCA
TGTCCGCCACAGGTCACCCACTGCCCAGGAAAAGCACACACAAGCCTCGTCACGGAGACTATCGCCATTTCCACA
ACTGTCTGCCCTGTCACCTCGACGCTTCCCGCCTCTACTCCGGCTTCCGCCGTCCCTGGGTCCAGCTCGACGTCT
ATGGAGCCCGAAACCGGCTCTGCCAGCCAGCCTGGTCAATCAGACACCGCATCTGCTGGTCAACCTGGAACGCCG
GCTGCCAGATATCCTGAACAGCCAGGCACTGCGTCTTCCAGCCAGCCGGGATCATCGTCTTCCGGCTCGCTTGGT
ATGCCATCTGCCAACTATCCCGAGCAGCCCGGCAGTACGTCTTTAGGTCAGTCGGAATTACCGTCTTCAAGTCAG
CCGGGATTGCCATCTCCTAGTCAGCCTGGTATGTCGCCTTCCAGCCAGCCGGGATCGTCTTCCGGCCAGGCCGGC
ATGCCGTCCGCTAGCCAGCCCGCACGTCTTCAAGTCAGTCGGGATCACCGTCTTCAAGTCAGCCCGGGTCGCCGT
CTTCTAGCAAGCCTGATATGCCATCTGCCAGCCAACCCGCCCGGTATGCCGTCCGCTAGTCCGCCCGGTATACCG
TCCGCTAGTCAGCCCGGTATGCCGTCTGCCATCTATCCTGAACGACCCGGCAGCACGTCTTCGAGTCAGTCGGGA
TCGCCATCTTCCGGCCAGCCTGGTATGCCTTCTGCCAGCCAGCCCGGATCGTCGTCTTCTACTAGCCAGCCCGGT
ATGCCGTCTGCTAGCCAGCCCGGTATGCCTTCTGCCATCTATCCTGAACAACCCGGCAGCACGTCTTCAAGTCTA
TCGGGATCGCCATCTTCCAGCCAGCCTGGTATGCCTTCTGCTAGCCAGCCTGGCCAGCCCGAAACCGCGCCTGCC
AGATACCCTCTTCAACCCGGCACTGAGTCTACTAGTAGTCTCGGACAGCCAACTTCCAGCCAGCCTAATCAACCC
GGCACCATGTCTTCCGGACAGCCCGGAACTGCTTCTTCGAGCCAGCCGCAGCCAACGAGCTGGACTACTTCGACC
ATGCACACGACCAGGGTTCACACCATTACCCAGTGCCCTCCGCAGGTGACCAACTGCCCTTACAAAGACCGCACG
ACCGTCATGACGGAAACGATGGCCATCTCAACCACGGTCTGCCCTGTGTCGCCTACGGGCCAGCCCAGTCAGCCG
GCCGGCATGCCTTCCGGACCTGGTGCCTCTGGCTCCAGCATGCCGGTCGGTACGCCTTCCGGTCCTGATACTCCT
GGCTCCAGCCAGTCGGCTACTACGCCTTCGGGTTCTAGCTCTAGTCAACCACCCCAGAAGCCTTCCGGATCAGGT
GCCCCTGGCTCTAGTCAGTCTCCTTCGATGCCTTCAGGTCCTAGCTATAGTCAGCCAGCCGAGACGCCCTCTGAG
TCTATTGCTCCTGGCTCTAGCCAGCCAGCCCCGACGTCTTCGAGCCCTGGATACGGTCAGCCATCCCAGAAACCT
TCTGGATCAGGAGCCCCTGGCTCCAGTCAGTCTCCTTCGATGCCTTCAGGTCCTGGCTATAGTCAGCCAGCCGAG
ACGCCCTCTAAGTCTATTGCCCCTGGCTCCAGCCAGTCGGTTTCGATGCCTTCGGGTTCTAGCTCTAGCCAGCCT
TCTGGTTCGCCTTCGATGCCCGGTGCTCCTGGTTCCAGCCAGCCAGCCATGACGCCTTCTTCTCCAGGCTACCGT
CAGCCTAGCCAGACGCCGCCTTCTGTACCTGATACTCCTGAGTCGACCCAGCCAGCACAGCCTGTTGGCATGCCC
TCTGGGCCAAGTGCTCCTGGCTCCAGCCAACCTGCTCAGATGCCTTCTGGTCCCGGCTACGGTCAGCCAGTTGGC
ATGCCTTCCGGGCCTAATGCTTCAGGTTCGAGTCAGCCGGCCAAGACGCCTTCTGGTCCCAGTGCTTCTGCTACG
ATGCCCTCCGGTCCTGGCTACAGTCCGCCGGCTGGTATGTCGTCGGGCCCCGGTGCTCCGGACTCCGGCCAGCCA
GCCATGACGCCTCCAGCTCCAGGCTCCAGCCAGTCTCCCTCTGGTCCCGGATACAGTCAGCCATCCGACAAGCCT
TCTGGACCCGACGCCCCTGACTCGGTCCCGTCCGTGTCCCTCTCTATGCTCCCAGCCAGCAAATTCTTGAGTCAG
TCGCAGCCAACAAGCTGGACCACGTCGACGATCCGTACAACAACCGTCAGAACCATCACCCACTGTCCTGCAGAG
CAGACCAAGTGTCCAAGTGGCGGTCACACCAAGGTCGTGACCGAGACCATCGCCTTGTCTACCACTGTGTGTCCG
GTTCAGCCCACGGGCCAGCCGTCTTCCGGTCCTGCTTCAAGCCAGCCGGGCCAGTCGTCTTCTTCTGGTCCTTAC
CCGAGTCAGTCCGACCAACCGTCTTCCGGTCCTGCTTCAAGCCAGCCGGGCCAGTCGTCTTCTTCTGGTCCTTAC
CCGGGTCAACCGTCTTCTGGTTCTGCCTCAAGCCAGTCAGGCCAGTCGTCGTCTGGTTCCGGCCCGGGCCAGACA
TCCGGCTCAGAAGCCCCCTCCCCCCCCGCGGGCACGAAGCCCTCGACATCAGCAGCGCAATACATGACACAAACC
TTGTCCATGCCCTCGTGCGCGCCGGACTCTTCCGACTGCGTCAATGACAGCGACTCCACCATGTCCTACCCCAGT
CCCTCGACTCTCGCATCCAAAATCAAGTCGTCCAACAGGGTCGCGACCGGGGAGTCGTCTACGGAGCAGTCGTCA
ACGGCCCAGCCTCAACCGGACGACGAGGAGGAGGAGAAGCCGTCGTCTACCCAGCAGGAGGCTCCTCAGTACGGC
TCGATGACTCCGGCATTCGGTGTCTCGGCGTCAATGACGACTAGCCCTGCCGTGGTCACCGCTGCTGCGGGACGC
GTCTCTGGCGGGGGTGTCAAGCTGGTTGCCGCCGTGGCCGGTATGCTGGCGCTCCTT
Transcript >Ophio5|1254
ATGGGTCCCCCAACGGCTCGAGCTCCCAACAACCCCAACTCAAGCACAAGCACAAGCACATTTATGTCTATGTCA
ATGGCAACGCGGCTGCCCGCTCCAATCAGGGACGCCGTCAGCCGCCGGGCAGGCGTCGTCGACGCACTTTCTCCG
GAGACACCACACGCAACGTGGGAACAAAGTGCGGATGGATGGATGCGTGGGTATGTGGGCTCCGTGCACATGCCT
CCTCACGCGCCCTGTGGTTTCAACGGCGTCTTCGTCCTGGGCGCTCTAGCCGCTGGCGTCGTCAGCGGCTGGAAA
TACCCTGACTGCGAGCATGACAACTGCTACCGCAACCTCATAGACAACCGCTTCGAGCATCTTGCCCCCAGGTTC
TGCATCGACTTCATCTCCGACCTTAGGAAGGACCCGTCGGAAATTCATCAAGAGTTCCGCAACAACTGTGGGAAC
GATGTGGGAAAAGTCAGCTCCGCCTGCTCGTGTGTCGCCTATACGGCTACCCACACCACTCAAGCCACCACGGCC
GTCATCGCACCCAGCGCGGACGCGCAGCCGACAGACTCGGCACCCGGCTACGGATCTTTCAGATTCATGCCGAAC
CAGAGATACCCGTCTCCGGGCGGCGGTGGCGGCGGCCAGTCTTCTAGACTCCCGGTACTTCTTGCTCTAGCTCTT
CCAGCTCCGCCGCTCCGAACTCGTCTGAACTCTACGGACTCGGACGGCTTCAGAGAAAGCCCTAGGGATTCAGAC
TCGGACTCGGACTCGGACGATTCTGGAGAAATGGCCACATCGATTTCCAGCCCCGGATCTCCAAGCTCTGTCCCT
GGCTACGGCTACCCTTCTGCACCAGGTGGCGATAGCTCGTCAGTCGCCCCAACGGCACCGGTAAAGCGCATCAAG
CCTTCCCTTCCGGTCCTCCCTGAAGCATCTCACTCCGGACCAAGCTTTGACTACCCCCCTCCGCAGGGTTCCAGC
TCTGGAGCCATGCCGTCTGCCTCGATGCCGAACCCGATGGATGACTCGACCTCGCTGTCGCCTGGTATAGGATCC
TCCAGCATGCCCATGACTACAATAGGTTGGACCACGTCGACTGTCAGCACCACAATGATCTACACCGTGACTTCA
TGTCCGCCACAGGTCACCCACTGCCCAGGAAAAGCACACACAAGCCTCGTCACGGAGACTATCGCCATTTCCACA
ACTGTCTGCCCTGTCACCTCGACGCTTCCCGCCTCTACTCCGGCTTCCGCCGTCCCTGGGTCCAGCTCGACGTCT
ATGGAGCCCGAAACCGGCTCTGCCAGCCAGCCTGGTCAATCAGACACCGCATCTGCTGGTCAACCTGGAACGCCG
GCTGCCAGATATCCTGAACAGCCAGGCACTGCGTCTTCCAGCCAGCCGGGATCATCGTCTTCCGGCTCGCTTGGT
ATGCCATCTGCCAACTATCCCGAGCAGCCCGGCAGTACGTCTTTAGGTCAGTCGGAATTACCGTCTTCAAGTCAG
CCGGGATTGCCATCTCCTAGTCAGCCTGGTATGTCGCCTTCCAGCCAGCCGGGATCGTCTTCCGGCCAGGCCGGC
ATGCCGTCCGCTAGCCAGCCCGCACGTCTTCAAGTCAGTCGGGATCACCGTCTTCAAGTCAGCCCGGGTCGCCGT
CTTCTAGCAAGCCTGATATGCCATCTGCCAGCCAACCCGCCCGGTATGCCGTCCGCTAGTCCGCCCGGTATACCG
TCCGCTAGTCAGCCCGGTATGCCGTCTGCCATCTATCCTGAACGACCCGGCAGCACGTCTTCGAGTCAGTCGGGA
TCGCCATCTTCCGGCCAGCCTGGTATGCCTTCTGCCAGCCAGCCCGGATCGTCGTCTTCTACTAGCCAGCCCGGT
ATGCCGTCTGCTAGCCAGCCCGGTATGCCTTCTGCCATCTATCCTGAACAACCCGGCAGCACGTCTTCAAGTCTA
TCGGGATCGCCATCTTCCAGCCAGCCTGGTATGCCTTCTGCTAGCCAGCCTGGCCAGCCCGAAACCGCGCCTGCC
AGATACCCTCTTCAACCCGGCACTGAGTCTACTAGTAGTCTCGGACAGCCAACTTCCAGCCAGCCTAATCAACCC
GGCACCATGTCTTCCGGACAGCCCGGAACTGCTTCTTCGAGCCAGCCGCAGCCAACGAGCTGGACTACTTCGACC
ATGCACACGACCAGGGTTCACACCATTACCCAGTGCCCTCCGCAGGTGACCAACTGCCCTTACAAAGACCGCACG
ACCGTCATGACGGAAACGATGGCCATCTCAACCACGGTCTGCCCTGTGTCGCCTACGGGCCAGCCCAGTCAGCCG
GCCGGCATGCCTTCCGGACCTGGTGCCTCTGGCTCCAGCATGCCGGTCGGTACGCCTTCCGGTCCTGATACTCCT
GGCTCCAGCCAGTCGGCTACTACGCCTTCGGGTTCTAGCTCTAGTCAACCACCCCAGAAGCCTTCCGGATCAGGT
GCCCCTGGCTCTAGTCAGTCTCCTTCGATGCCTTCAGGTCCTAGCTATAGTCAGCCAGCCGAGACGCCCTCTGAG
TCTATTGCTCCTGGCTCTAGCCAGCCAGCCCCGACGTCTTCGAGCCCTGGATACGGTCAGCCATCCCAGAAACCT
TCTGGATCAGGAGCCCCTGGCTCCAGTCAGTCTCCTTCGATGCCTTCAGGTCCTGGCTATAGTCAGCCAGCCGAG
ACGCCCTCTAAGTCTATTGCCCCTGGCTCCAGCCAGTCGGTTTCGATGCCTTCGGGTTCTAGCTCTAGCCAGCCT
TCTGGTTCGCCTTCGATGCCCGGTGCTCCTGGTTCCAGCCAGCCAGCCATGACGCCTTCTTCTCCAGGCTACCGT
CAGCCTAGCCAGACGCCGCCTTCTGTACCTGATACTCCTGAGTCGACCCAGCCAGCACAGCCTGTTGGCATGCCC
TCTGGGCCAAGTGCTCCTGGCTCCAGCCAACCTGCTCAGATGCCTTCTGGTCCCGGCTACGGTCAGCCAGTTGGC
ATGCCTTCCGGGCCTAATGCTTCAGGTTCGAGTCAGCCGGCCAAGACGCCTTCTGGTCCCAGTGCTTCTGCTACG
ATGCCCTCCGGTCCTGGCTACAGTCCGCCGGCTGGTATGTCGTCGGGCCCCGGTGCTCCGGACTCCGGCCAGCCA
GCCATGACGCCTCCAGCTCCAGGCTCCAGCCAGTCTCCCTCTGGTCCCGGATACAGTCAGCCATCCGACAAGCCT
TCTGGACCCGACGCCCCTGACTCGGTCCCGTCCGTGTCCCTCTCTATGCTCCCAGCCAGCAAATTCTTGAGTCAG
TCGCAGCCAACAAGCTGGACCACGTCGACGATCCGTACAACAACCGTCAGAACCATCACCCACTGTCCTGCAGAG
CAGACCAAGTGTCCAAGTGGCGGTCACACCAAGGTCGTGACCGAGACCATCGCCTTGTCTACCACTGTGTGTCCG
GTTCAGCCCACGGGCCAGCCGTCTTCCGGTCCTGCTTCAAGCCAGCCGGGCCAGTCGTCTTCTTCTGGTCCTTAC
CCGAGTCAGTCCGACCAACCGTCTTCCGGTCCTGCTTCAAGCCAGCCGGGCCAGTCGTCTTCTTCTGGTCCTTAC
CCGGGTCAACCGTCTTCTGGTTCTGCCTCAAGCCAGTCAGGCCAGTCGTCGTCTGGTTCCGGCCCGGGCCAGACA
TCCGGCTCAGAAGCCCCCTCCCCCCCCGCGGGCACGAAGCCCTCGACATCAGCAGCGCAATACATGACACAAACC
TTGTCCATGCCCTCGTGCGCGCCGGACTCTTCCGACTGCGTCAATGACAGCGACTCCACCATGTCCTACCCCAGT
CCCTCGACTCTCGCATCCAAAATCAAGTCGTCCAACAGGGTCGCGACCGGGGAGTCGTCTACGGAGCAGTCGTCA
ACGGCCCAGCCTCAACCGGACGACGAGGAGGAGGAGAAGCCGTCGTCTACCCAGCAGGAGGCTCCTCAGTACGGC
TCGATGACTCCGGCATTCGGTGTCTCGGCGTCAATGACGACTAGCCCTGCCGTGGTCACCGCTGCTGCGGGACGC
GTCTCTGGCGGGGGTGTCAAGCTGGTTGCCGCCGTGGCCGGTATGCTGGCGCTCCTTTAG
Gene >Ophio5|1254
ATGGGTCCCCCAACGGCTCGAGCTCCCAACAACCCCAACTCAAGCACAAGCACAAGCACATTTATGTCTATGTCA
ATGGCAACGCGGCTGCCCGCTCCAATCAGGGACGCCGTCAGCCGCCGGGCAGGCGTCGTCGACGCACGTAAATGA
TGCAACGTGGGCTATAAACAGCAACTCGTCAAGGGGGGGGGGGGGGCGGGGGGGGGGGGAAGAAAAAGAAGGTAA
ATATATGTAATCCTGCTAGACGAGGCACACTATACATATCTTTCCACCTACAGTTTCTCCGGAGACACCACACGC
AACGTGGGAACAAAGTGCGGATGGATGGATGCGTGGGTATGTGGGCTCCGTGCACATGGTTCGTACAGACAACCC
GTCCGCCATCCATCCATGTTGGAACGAGGGCTGTGCTGCCAACTGATCCTTGCCCACGTCCATGGATTGGACAGC
CTCCTGTATGGAATAAATAGGCGAAGCCCTCCCATTCGACCCAAGGGGAAGCAAGCACGCGCCCTGTGGTTTCAA
CGGTAGGTCGGTCTTTCGACTCCTTTCATCTCTCTCTTCCAGATAGAACACTACCCTATCTTGTCAATCATTCTT
GCCATCCACTCTCACTATCACTTCTCTCCTCCTTTCCTCTGTCAGTAAGACGTCAGTCGTCTATATACACACTCT
CTCCCCCTTGTATCATCACCACCTCGGCCGCGCAACACCGCAGAGACGCAAGAGGAGACGTCGACCATCAGACGT
TGACACCATGAAAGGCGTCTTCGTCCTGGGCGCTCTAGCCGCTGGCGTCGTCAGCGGCTGGAAATACCCTGACTG
CGAGCATGACAACTGCTACCGCAACCTCATAGACAACCGCTTCGAGCATCTTGCCCCCAGGTTCTGCATCGACTT
CATCTCCGACCTTAGGAAGGACCCGTCGGAAATTCATCAAGAGTTCCGCAACAACTGTGGGAACGATGTGGGAAA
AGTCAGCTCCGCCTGCTCGTGTGTCGCCTATACGGCTACCCACACCACTCAAGCCACCACGGCCGTCATCGCACC
CAGCGCGGACGCGCAGCCGACAGACTCGGCACCCGGCTACGGATCTTTCAGATTCATGCCGAACCAGAGATACCC
GTCTCCGGGCGGCGGTGGCGGCGGCCAGTCTTCTAGAGTTCCGTCTGAGCCCGCGTCGGACCATCAGCCTTCCGC
TCCAGCTCCCGGTACTTCTTGCTCTAGCTCTTCCAGCTCCGCCGCTCCGAACTCGTCTGAAGTGAGCGACCAGCC
CACCCCTTCGATGTCTTCAGCGCCAGCTGGCTATGGGGCAAGTTCCTCGACCCTAAGCGCCCCGACATCTAGCTC
TACGGACTCGGACGGCTTCAGAGAAAGCCCTAGGGATTCAGACTCGGACTCGGACTCGGACGATTCTGGAGAAAT
GGCCACATCGATTTCCAGCCCCGGATCTCCAAGCTCTGTCCCTGGCTACGGCTACCCTTCTGCACCAGGTGGCGA
TAGCTCGTCAGTCGCCCCAACGGCACCGGTAAAGCGCATCAAGCCTTCCCTTCCGGTCCTCCCTGAAGCATCTCA
CTCCGGACCAAGCTTTGACTACCCCCCTCCGCAGGGTTCCAGCTCTGGAGCCATGCCGTCTGCCTCGATGCCGAA
CCCGATGGATGACTCGACCTCGCTGTCGCCTGGTATAGGATCCTCCAGCATGCCCATGACTACAATAGGTTGGAC
CACGTCGACTGTCAGCACCACAATGATCTACACCGTGACTTCATGTCCGCCACAGGTCACCCACTGCCCAGGAAA
AGCACACACAAGCCTCGTCACGGAGACTATCGCCATTTCCACAACTGTCTGCCCTGTCACCTCGACGCTTCCCGC
CTCTACTCCGGCTTCCGCCGTCCCTGGGTCCAGCTCGACGTCTATGGAGCCCGAAACCGGCTCTGCCAGCCAGCC
TGGTCAATCAGACACCGCATCTGCTGGTCAACCTGGAACGCCGGCTGCCAGATATCCTGAACAGCCAGGCACTGC
GTCTTCCAGCCAGCCGGGATCATCGTCTTCCGGCTCGCTTGGTATGCCATCTGCCAACTATCCCGAGCAGCCCGG
CAGTACGTCTTTAGGTCAGTCGGAATTACCGTCTTCAAGTCAGCCGGGATTGCCATCTCCTAGTCAGCCTGGTAT
GTCGCCTTCCAGCCAGCCGGGATCGTCTTCCGGCCAGGCCGGCATGCCGTCCGCTAGCCAGCCCGGTATGCCGTC
CGCTAGCCAGCCCGGTATGCCGTCTGCCATCTATCCTAAACAACCCGGCAGCACGTCTTCAAGTCAGTCGGGATC
ACCGTCTTCAAGTCAGCCCGGGTCGCCGTCTTCTAGCAAGCCTGATATGCCATCTGCCAGCCAACCCGGTATGTC
GTCTACTAGCCAGCCGGGGTCGTCGTCTTCCAGCCAAGCCGGCATGCCTTCTGCTAGCCAGCCCGGTATGCCGTC
CGCTAGTCCGCCCGGTATACCGTCCGCTAGTCAGCCCGGTATGCCGTCTGCCATCTATCCTGAACGACCCGGCAG
CACGTCTTCGAGTCAGTCGGGATCGCCATCTTCCGGCCAGCCTGGTATGCCTTCTGCCAGCCAGCCCGGATCGTC
GTCTTCTACTAGCCAGCCCGGTATGCCGTCTGCTAGCCAGCCCGGTATGCCTTCTGCCATCTATCCTGAACAACC
CGGCAGCACGTCTTCAAGTCTATCGGGATCGCCATCTTCCAGCCAGCCTGGTATGCCTTCTGCTAGCCAGCCTGG
CCAGCCCGAAACCGCGCCTGCCAGATACCCTCTTCAACCCGGCACTGAGTCTACTAGTAGTCTCGGACAGCCAAC
TTCCAGCCAGCCTAATCAACCCGGCACCATGTCTTCCGGACAGCCCGGAACTGCTTCTTCGAGCCAGCCGCAGCC
AACGAGCTGGACTACTTCGACCATGCACACGACCAGGGTTCACACCATTACCCAGTGCCCTCCGCAGGTGACCAA
CTGCCCTTACAAAGACCGCACGACCGTCATGACGGAAACGATGGCCATCTCAACCACGGTCTGCCCTGTGTCGCC
TACGGGCCAGCCCAGTCAGCCGGCCGGCATGCCTTCCGGACCTGGTGCCTCTGGCTCCAGCATGCCGGTCGGTAC
GCCTTCCGGTCCTGATACTCCTGGCTCCAGCCAGTCGGCTACTACGCCTTCGGGTTCTAGCTCTAGTCAACCACC
CCAGAAGCCTTCCGGATCAGGTGCCCCTGGCTCTAGTCAGTCTCCTTCGATGCCTTCAGGTCCTAGCTATAGTCA
GCCAGCCGAGACGCCCTCTGAGTCTATTGCTCCTGGCTCTAGCCAGCCAGCCCCGACGTCTTCGAGCCCTGGATA
CGGTCAGCCATCCCAGAAACCTTCTGGATCAGGAGCCCCTGGCTCCAGTCAGTCTCCTTCGATGCCTTCAGGTCC
TGGCTATAGTCAGCCAGCCGAGACGCCCTCTAAGTCTATTGCCCCTGGCTCCAGCCAGTCGGTTTCGATGCCTTC
GGGTTCTAGCTCTAGCCAGCCTTCTGGTTCGCCTTCGATGCCCGGTGCTCCTGGTTCCAGCCAGCCAGCCATGAC
GCCTTCTTCTCCAGGCTACCGTCAGCCTAGCCAGACGCCGCCTTCTGTACCTGATACTCCTGAGTCGACCCAGCC
AGCACAGCCTGTTGGCATGCCCTCTGGGCCAAGTGCTCCTGGCTCCAGCCAACCTGCTCAGATGCCTTCTGGTCC
CGGCTACGGTCAGCCAGTTGGCATGCCTTCCGGGCCTAATGCTTCAGGTTCGAGTCAGCCGGCCAAGACGCCTTC
TGGTCCCAGTGCTTCTGCTACGATGCCCTCCGGTCCTGGCTACAGTCCGCCGGCTGGTATGTCGTCGGGCCCCGG
TGCTCCGGACTCCGGCCAGCCAGCCATGACGCCTCCAGCTCCAGGCTCCAGCCAGTCTCCCTCTGGTCCCGGATA
CAGTCAGCCATCCGACAAGCCTTCTGGACCCGACGCCCCTGACTCGGTCCCGTCCGTGTCCCTCTCTATGCTCCC
AGCCAGCAAATTCTTGAGTCAGTCGCAGCCAACAAGCTGGACCACGTCGACGATCCGTACAACAACCGTCAGAAC
CATCACCCACTGTCCTGCAGAGCAGACCAAGTGTCCAAGTGGCGGTCACACCAAGGTCGTGACCGAGACCATCGC
CTTGTCTACCACTGTGTGTCCGGTTCAGCCCACGGGCCAGCCGTCTTCCGGTCCTGCTTCAAGCCAGCCGGGCCA
GTCGTCTTCTTCTGGTCCTTACCCGAGTCAGTCCGACCAACCGTCTTCCGGTCCTGCTTCAAGCCAGCCGGGCCA
GTCGTCTTCTTCTGGTCCTTACCCGGGTCAACCGTCTTCTGGTTCTGCCTCAAGCCAGTCAGGCCAGTCGTCGTC
TGGTTCCGGCCCGGGCCAGACATCCGGCTCAGAAGCCCCCTCCCCCCCCGCGGGCACGAAGCCCTCGACATCAGC
AGCGCAATACATGACACAAACCTTGTCCATGCCCTCGTGCGCGCCGGACTCTTCCGACTGCGTCAATGACAGCGA
CTCCACCATGTCCTACCCCAGTCCCTCGACTCTCGCATCCAAAATCAAGTCGTCCAACAGGGTCGCGACCGGGGA
GTCGTCTACGGAGCAGTCGTCAACGGCCCAGCCTCAACCGGACGACGAGGAGGAGGAGAAGCCGTCGTCTACCCA
GCAGGAGGCTCCTCAGTACGGCTCGATGACTCCGGCATTCGGTGTCTCGGCGTCAATGACGACTAGCCCTGCCGT
GGTCACCGCTGCTGCGGGACGCGTCTCTGGCGGGGGTGTCAAGCTGGTTGCCGCCGTGGCCGGTATGCTGGCGCT
CCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail