Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1226
Gene name
Locationscaffold_14:43307..45315
Strand-
Gene length (bp)2008
Transcript length (bp)1653
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 1.6E-128 63 510
PF13520 AA_permease_2 Amino acid permease 7.4E-35 58 471

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0V0|YQD2_SCHPO Probable amino-acid permease PB1C11.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.02 PE=3 SV=1 52 522 6.0E-159
sp|P25737|LYSP_ECOLI Lysine-specific permease OS=Escherichia coli (strain K12) GN=lysP PE=1 SV=5 54 522 2.0E-130
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 40 539 1.0E-102
sp|O60170|MEU22_SCHPO Probable amino-acid permease meu22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu22 PE=2 SV=1 3 532 2.0E-102
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 26 540 2.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0V0|YQD2_SCHPO Probable amino-acid permease PB1C11.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.02 PE=3 SV=1 52 522 6.0E-159
sp|P25737|LYSP_ECOLI Lysine-specific permease OS=Escherichia coli (strain K12) GN=lysP PE=1 SV=5 54 522 2.0E-130
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 40 539 1.0E-102
sp|O60170|MEU22_SCHPO Probable amino-acid permease meu22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu22 PE=2 SV=1 3 532 2.0E-102
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 26 540 2.0E-102
sp|P25376|AGP1_YEAST General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP1 PE=1 SV=3 23 548 3.0E-100
sp|Q9P768|YI26_SCHPO Uncharacterized amino-acid permease P7G5.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP7G5.06 PE=3 SV=1 15 533 1.0E-99
sp|A6ZTG5|AGP1_YEAS7 General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=AGP1 PE=3 SV=1 23 548 2.0E-99
sp|Q876K6|AGP1_SACU7 General amino acid permease AGP1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AGP1 PE=3 SV=1 2 548 2.0E-99
sp|Q9URZ4|CAT1_SCHPO Cationic amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cat1 PE=1 SV=3 27 539 6.0E-97
sp|P38971|ALP1_YEAST Basic amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALP1 PE=1 SV=2 25 549 2.0E-94
sp|Q9P5N2|AAT1_SCHPO Amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aat1 PE=3 SV=1 39 541 1.0E-93
sp|B5BP45|YP51_SCHPO Uncharacterized amino-acid permease C460.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.01c PE=3 SV=1 22 545 5.0E-93
sp|P53388|DIP5_YEAST Dicarboxylic amino acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP5 PE=1 SV=1 39 543 2.0E-92
sp|Q9P5N4|YH81_SCHPO Uncharacterized amino-acid permease C359.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC359.01 PE=3 SV=2 2 540 3.0E-92
sp|P06775|HIP1_YEAST Histidine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIP1 PE=1 SV=2 1 527 2.0E-90
sp|P19145|GAP1_YEAST General amino-acid permease GAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAP1 PE=1 SV=2 54 548 2.0E-88
sp|O59831|YCUB_SCHPO Uncharacterized amino-acid permease C965.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.11c PE=3 SV=1 50 542 4.0E-88
sp|O74543|YCV4_SCHPO Uncharacterized amino-acid permease C777.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.04 PE=3 SV=1 30 520 1.0E-87
sp|P48813|GNP1_YEAST High-affinity glutamine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GNP1 PE=1 SV=2 50 548 3.0E-86
sp|P41815|BAP3_YEAST Valine amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP3 PE=1 SV=2 16 544 6.0E-85
sp|P18696|PUTX_EMENI Proline-specific permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prnB PE=2 SV=2 55 542 1.0E-84
sp|P38084|BAP2_YEAST Leu/Val/Ile amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP2 PE=1 SV=2 7 546 3.0E-84
sp|P15380|PUT4_YEAST Proline-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT4 PE=2 SV=2 1 532 3.0E-84
sp|Q9URZ3|PUT4_SCHPO Probable proline-specific permease put4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=put4 PE=3 SV=1 27 544 1.0E-83
sp|P38967|TAT2_YEAST Tryptophan permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT2 PE=1 SV=1 51 537 8.0E-83
sp|P34054|INDA1_HYPAT Amino-acid permease inda1 OS=Hypocrea atroviridis GN=inda1 PE=2 SV=1 38 548 2.0E-81
sp|P43059|CAN1_CANAW Lysine/arginine permease OS=Candida albicans (strain WO-1) GN=CAN1 PE=3 SV=2 53 538 7.0E-81
sp|P40901|ISP5_SCHPO Sexual differentiation process putative amino-acid permease isp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp5 PE=2 SV=2 50 536 1.0E-80
sp|Q9HDV2|YHE1_SCHPO Uncharacterized amino-acid permease PB2B2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.01 PE=3 SV=1 35 549 2.0E-80
sp|P43548|AGP3_YEAST General amino acid permease AGP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP3 PE=1 SV=1 40 539 1.0E-78
sp|P39137|ROCE_BACSU Amino-acid permease RocE OS=Bacillus subtilis (strain 168) GN=rocE PE=2 SV=1 52 519 2.0E-76
sp|P38090|AGP2_YEAST General amino acid permease AGP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP2 PE=1 SV=1 16 543 4.0E-76
sp|P39636|ROCC_BACSU Amino-acid permease RocC OS=Bacillus subtilis (strain 168) GN=rocC PE=2 SV=1 50 500 4.0E-74
sp|P38085|TAT1_YEAST Valine/tyrosine/tryptophan amino-acid permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT1 PE=1 SV=1 2 536 6.0E-74
sp|P42087|HUTM_BACSU Putative histidine permease OS=Bacillus subtilis (strain 168) GN=hutM PE=3 SV=2 51 522 2.0E-72
sp|Q8FL49|AROP_ECOL6 Aromatic amino acid transport protein AroP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroP PE=3 SV=1 50 509 2.0E-72
sp|P59737|AROP_SHIFL Aromatic amino acid transport protein AroP OS=Shigella flexneri GN=aroP PE=3 SV=1 50 509 7.0E-72
sp|P15993|AROP_ECOLI Aromatic amino acid transport protein AroP OS=Escherichia coli (strain K12) GN=aroP PE=1 SV=3 50 509 1.0E-71
sp|P46349|GABP_BACSU GABA permease OS=Bacillus subtilis (strain 168) GN=gabP PE=1 SV=3 54 463 1.0E-71
sp|Q8X968|AROP_ECO57 Aromatic amino acid transport protein AroP OS=Escherichia coli O157:H7 GN=aroP PE=3 SV=1 50 472 2.0E-71
sp|Q12372|MMP1_YEAST S-methylmethionine permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMP1 PE=1 SV=1 55 529 5.0E-71
sp|Q92367|AAP1_SCHPO Amino-acid permease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aap1 PE=3 SV=1 46 450 8.0E-71
sp|O34618|YTNA_BACSU Uncharacterized amino acid permease YtnA OS=Bacillus subtilis (strain 168) GN=ytnA PE=3 SV=1 50 479 2.0E-70
sp|P27837|YIFK_ECOLI Probable transport protein YifK OS=Escherichia coli (strain K12) GN=yifK PE=1 SV=4 50 516 4.0E-70
sp|P24207|PHEP_ECOLI Phenylalanine-specific permease OS=Escherichia coli (strain K12) GN=pheP PE=1 SV=1 50 508 5.0E-70
sp|P0CK99|AROP_SALTY Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroP PE=3 SV=1 50 457 6.0E-69
sp|E1W822|AROP_SALTS Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain SL1344) GN=aroP PE=3 SV=1 50 457 6.0E-69
sp|P0A188|AROP_SALTI Aromatic amino acid transport protein AroP OS=Salmonella typhi GN=aroP PE=3 SV=1 50 457 6.0E-69
sp|Q47689|MMUP_ECOLI Probable S-methylmethionine permease OS=Escherichia coli (strain K12) GN=mmuP PE=3 SV=2 50 500 9.0E-69
sp|P96704|YDGF_BACSU Uncharacterized transporter YdgF OS=Bacillus subtilis (strain 168) GN=ydgF PE=3 SV=1 49 452 7.0E-68
sp|P0A189|YIFK_SALTY Probable transport protein YifK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yifK PE=3 SV=1 50 456 1.0E-67
sp|P0A190|YIFK_SALTI Probable transport protein YifK OS=Salmonella typhi GN=yifK PE=3 SV=1 50 456 1.0E-67
sp|Q08986|SAM3_YEAST S-adenosylmethionine permease SAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM3 PE=1 SV=1 18 536 7.0E-67
sp|P9WQM7|ANSP2_MYCTU L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP2 PE=1 SV=1 36 527 1.0E-66
sp|P9WQM6|ANSP2_MYCTO L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP2 PE=3 SV=1 36 527 1.0E-66
sp|P0A4W1|ANSP2_MYCBO L-asparagine permease 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP2 PE=3 SV=1 36 527 1.0E-66
sp|O31462|YBGF_BACSU Uncharacterized amino acid permease YbgF OS=Bacillus subtilis (strain 168) GN=ybgF PE=3 SV=1 54 508 2.0E-65
sp|P0AAE0|CYCA_ECOLI D-serine/D-alanine/glycine transporter OS=Escherichia coli (strain K12) GN=cycA PE=1 SV=1 51 383 4.0E-64
sp|P0AAE1|CYCA_ECO57 D-serine/D-alanine/glycine transporter OS=Escherichia coli O157:H7 GN=cycA PE=3 SV=1 51 383 4.0E-64
sp|P37460|PROY_SALTY Proline-specific permease ProY OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proY PE=3 SV=3 51 508 1.0E-62
sp|Q46065|AROP_CORGL Aromatic amino acid transport protein AroP OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aroP PE=3 SV=1 51 456 7.0E-62
sp|P77610|ANSP_ECOLI L-asparagine permease OS=Escherichia coli (strain K12) GN=ansP PE=3 SV=2 26 459 5.0E-60
sp|P0AAE2|PROY_ECOLI Proline-specific permease ProY OS=Escherichia coli (strain K12) GN=proY PE=1 SV=1 51 508 2.0E-59
sp|P0AAE3|PROY_ECOL6 Proline-specific permease ProY OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=proY PE=3 SV=1 51 508 2.0E-59
sp|P0AAE4|PROY_ECO57 Proline-specific permease ProY OS=Escherichia coli O157:H7 GN=proY PE=3 SV=1 51 508 2.0E-59
sp|P25527|GABP_ECOLI GABA permease OS=Escherichia coli (strain K12) GN=gabP PE=1 SV=1 50 475 4.0E-59
sp|O06005|AAPA_BACSU Amino-acid permease AapA OS=Bacillus subtilis (strain 168) GN=aapA PE=3 SV=2 48 471 1.0E-58
sp|P54425|YBXG_BACSU Uncharacterized transporter YbxG OS=Bacillus subtilis (strain 168) GN=ybxG PE=3 SV=2 51 510 2.0E-58
sp|P40812|ANSP_SALTY L-asparagine permease OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ansP PE=3 SV=1 26 459 2.0E-58
sp|P9WQM9|ANSP1_MYCTU L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP1 PE=1 SV=1 55 453 4.0E-57
sp|P9WQM8|ANSP1_MYCTO L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP1 PE=3 SV=1 55 453 4.0E-57
sp|Q7VEQ4|ANSP1_MYCBO L-asparagine permease 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP1 PE=3 SV=1 36 453 1.0E-56
sp|Q03770|SSY1_YEAST SPS-sensor component SSY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSY1 PE=1 SV=1 49 549 8.0E-53
sp|Q9X7P0|ANSP_STRCO L-asparagine permease OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ansP PE=3 SV=1 56 473 8.0E-53
sp|Q9I703|BAUD_PSEAE Probable GABA permease OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bauD PE=2 SV=1 50 463 3.0E-52
sp|O32257|YVBW_BACSU Uncharacterized amino acid permease YvbW OS=Bacillus subtilis (strain 168) GN=yvbW PE=2 SV=1 51 469 1.0E-51
sp|P45495|YPEV_LACDL Uncharacterized transporter in pepV 3'region (Fragment) OS=Lactobacillus delbrueckii subsp. lactis PE=3 SV=1 50 216 3.0E-28
sp|P94383|YCGH_BACSU Uncharacterized transporter YcgH OS=Bacillus subtilis (strain 168) GN=ycgH PE=3 SV=3 50 446 9.0E-28
sp|Q797A7|YFNA_BACSU Uncharacterized amino acid permease YfnA OS=Bacillus subtilis (strain 168) GN=yfnA PE=3 SV=1 50 449 1.0E-17
sp|A8I499|CTR2_PIG Cationic amino acid transporter 2 OS=Sus scrofa GN=SLC7A2 PE=2 SV=1 49 396 2.0E-12
sp|Q8GYB4|CAAT3_ARATH Cationic amino acid transporter 3, mitochondrial OS=Arabidopsis thaliana GN=CAT3 PE=2 SV=1 30 434 2.0E-12
sp|Q9ASS7|CAAT2_ARATH Cationic amino acid transporter 2, vacuolar OS=Arabidopsis thaliana GN=CAT2 PE=2 SV=1 30 434 5.0E-12
sp|Q45577|YBEC_BACSU Probable amino acid-proton symporter YbeC OS=Bacillus subtilis (strain 168) GN=ybeC PE=3 SV=3 52 502 8.0E-12
sp|B5D5N9|CTR2_RAT Cationic amino acid transporter 2 OS=Rattus norvegicus GN=Slc7a2 PE=1 SV=1 49 396 3.0E-11
sp|Q8X845|FRLA_ECO57 Putative fructoselysine transporter FrlA OS=Escherichia coli O157:H7 GN=frlA PE=3 SV=2 51 283 3.0E-11
sp|P45539|FRLA_ECOLI Putative fructoselysine transporter FrlA OS=Escherichia coli (strain K12) GN=frlA PE=3 SV=2 51 283 6.0E-11
sp|P52569|CTR2_HUMAN Cationic amino acid transporter 2 OS=Homo sapiens GN=SLC7A2 PE=1 SV=2 49 396 6.0E-11
sp|B3TP03|CTR2_CHICK Cationic amino acid transporter 2 OS=Gallus gallus GN=SLC7A2 PE=2 SV=1 38 396 9.0E-11
sp|P18581|CTR2_MOUSE Cationic amino acid transporter 2 OS=Mus musculus GN=Slc7a2 PE=1 SV=3 49 396 1.0E-10
sp|Q9WVR6|LAT2_RAT Large neutral amino acids transporter small subunit 2 OS=Rattus norvegicus GN=Slc7a8 PE=1 SV=1 26 422 6.0E-10
sp|Q6DCE8|CTR2_XENLA Cationic amino acid transporter 2 OS=Xenopus laevis GN=slc7a2 PE=2 SV=1 35 396 7.0E-10
sp|Q8W4K3|CAAT4_ARATH Cationic amino acid transporter 4, vacuolar OS=Arabidopsis thaliana GN=CAT4 PE=2 SV=1 39 435 9.0E-10
sp|O07576|YHDG_BACSU Uncharacterized amino acid permease YhdG OS=Bacillus subtilis (strain 168) GN=yhdG PE=2 SV=1 52 500 3.0E-09
sp|Q5RAE3|LAT2_PONAB Large neutral amino acids transporter small subunit 2 OS=Pongo abelii GN=SLC7A8 PE=2 SV=2 54 422 1.0E-08
sp|Q9UHI5|LAT2_HUMAN Large neutral amino acids transporter small subunit 2 OS=Homo sapiens GN=SLC7A8 PE=1 SV=1 54 422 1.0E-08
sp|P70423|CTR3_MOUSE Cationic amino acid transporter 3 OS=Mus musculus GN=Slc7a3 PE=2 SV=1 53 395 1.0E-08
sp|Q9QXW9|LAT2_MOUSE Large neutral amino acids transporter small subunit 2 OS=Mus musculus GN=Slc7a8 PE=1 SV=1 27 422 1.0E-08
sp|O43246|CTR4_HUMAN Cationic amino acid transporter 4 OS=Homo sapiens GN=SLC7A4 PE=2 SV=3 54 383 2.0E-08
sp|O08812|CTR3_RAT Cationic amino acid transporter 3 OS=Rattus norvegicus GN=Slc7a3 PE=2 SV=1 53 394 3.0E-08
sp|Q8WY07|CTR3_HUMAN Cationic amino acid transporter 3 OS=Homo sapiens GN=SLC7A3 PE=1 SV=1 53 444 3.0E-08
sp|Q9N1Q4|LAT2_RABIT Large neutral amino acids transporter small subunit 2 OS=Oryctolagus cuniculus GN=SLC7A8 PE=1 SV=1 26 422 4.0E-08
sp|Q8BLQ7|CTR4_MOUSE Cationic amino acid transporter 4 OS=Mus musculus GN=Slc7a4 PE=1 SV=1 54 388 6.0E-08
sp|B0UYF2|S7A14_DANRE Probable cationic amino acid transporter OS=Danio rerio GN=slc7a14a PE=3 SV=1 53 392 6.0E-08
sp|Q9QXA6|BAT1_MOUSE b(0,+)-type amino acid transporter 1 OS=Mus musculus GN=Slc7a9 PE=1 SV=1 28 382 2.0E-07
sp|Q5PR34|CTR2_DANRE Cationic amino acid transporter 2 OS=Danio rerio GN=slc7a2 PE=2 SV=1 38 383 3.0E-07
sp|Q9N1R6|BAT1_RABIT b(0,+)-type amino acid transporter 1 OS=Oryctolagus cuniculus GN=SLC7A9 PE=1 SV=1 33 470 4.0E-07
sp|P30823|CTR1_RAT High affinity cationic amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a1 PE=2 SV=1 50 396 4.0E-07
sp|O64759|CAAT5_ARATH Cationic amino acid transporter 5 OS=Arabidopsis thaliana GN=CAT5 PE=1 SV=1 37 332 7.0E-07
sp|Q8TBB6|S7A14_HUMAN Probable cationic amino acid transporter OS=Homo sapiens GN=SLC7A14 PE=2 SV=3 53 392 8.0E-07
sp|Q92536|YLAT2_HUMAN Y+L amino acid transporter 2 OS=Homo sapiens GN=SLC7A6 PE=1 SV=3 23 371 1.0E-06
sp|Q09143|CTR1_MOUSE High affinity cationic amino acid transporter 1 OS=Mus musculus GN=Slc7a1 PE=1 SV=1 50 396 2.0E-06
sp|A0JNI9|S7A14_BOVIN Probable cationic amino acid transporter OS=Bos taurus GN=SLC7A14 PE=2 SV=1 42 392 3.0E-06
sp|P30825|CTR1_HUMAN High affinity cationic amino acid transporter 1 OS=Homo sapiens GN=SLC7A1 PE=1 SV=1 53 396 4.0E-06
sp|P82252|BAT1_RAT b(0,+)-type amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a9 PE=1 SV=1 28 382 4.0E-06
sp|Q8BXR1|S7A14_MOUSE Probable cationic amino acid transporter OS=Mus musculus GN=Slc7a14 PE=1 SV=1 42 392 8.0E-06
sp|Q8TCU3|S7A13_HUMAN Solute carrier family 7 member 13 OS=Homo sapiens GN=SLC7A13 PE=2 SV=1 72 388 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 63 85 22
2 92 111 19
3 171 193 22
4 200 222 22
5 237 259 22
6 286 308 22
7 328 350 22
8 382 404 22
9 409 431 22
10 452 474 22
11 484 506 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 22.51 10.96 34.07
CcL In ants, during behavior modification 18.20 7.79 28.60
CcD In ants, recently dead 16.23 7.32 25.14

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.455212 no
SC16a CcD 0.219625 no
CcL CcD 0.725780 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1226
MKESPASAHEAVAFTHAESAPMSAIHDDEKSAEKREERRDDDGEGLVFVRSDRLRRSLSARQVQMIAIGGTIGTG
LFLGSGKSLATGGPASMLLCYAIVGAIVFVTMLSLGEMSAFVPVAGSFCSFSGRFVDDAFGFALTWNYWFNDAVS
TASDLVALQLVLQYWTDRFPGWALSLIFWALLVAVNVASVRAYGELEYWLSLLKVITIMVFIVVGIVVNVGGNLE
GRYIGVENWRLPGGPFVGGIGGFASVFVTASFAYGGTESIAITAGETKNPTKTMPRVVKNVFWRILFFYILSVLL
IGLNVPYTYPNLSSKNTSTSPFTIVFQMTGARAAGSVINAVILTSVLSAGNHALFAAGRLLYTLAAEGHAPRAFA
RLGKNQVPWVAVLTSAFIAGLCFASSFIGAGQLWTWLQNIVGVSNQLSWIAIGIASIRFRSGLERQGKTRLLPFR
NWTYPWGPWAVVILNSFLVLIQGWRCFTPRFDPVSFVSFYIELPIMLVMYIGWKVWRRTKLVGLDEMDLETDVHT
ADEEPLEAADKNWRARVKRVADWLF
Coding >Ophio5|1226
ATGAAAGAATCGCCGGCGTCGGCACACGAGGCCGTCGCATTCACGCACGCCGAATCTGCCCCCATGAGCGCAATA
CACGATGATGAAAAATCAGCTGAGAAGCGCGAAGAACGACGCGATGATGATGGCGAGGGCCTCGTCTTCGTCCGT
TCGGACCGGCTGAGGCGCTCGCTATCGGCGCGACAAGTTCAGATGATTGCCATCGGCGGCACCATCGGCACCGGC
CTGTTTCTCGGATCCGGAAAATCGCTGGCGACGGGAGGGCCGGCGTCGATGTTGTTGTGCTACGCTATTGTCGGC
GCTATCGTTTTTGTCACGATGCTGAGCTTGGGGGAGATGTCGGCCTTTGTGCCCGTCGCCGGCAGCTTTTGCTCT
TTTTCTGGCCGCTTCGTCGACGACGCCTTCGGCTTCGCCCTCACCTGGAACTACTGGTTCAACGATGCGGTGTCG
ACCGCGTCGGACCTCGTCGCCCTACAGCTTGTGCTGCAGTATTGGACCGACCGATTCCCCGGCTGGGCGCTGAGT
CTCATCTTCTGGGCCCTTCTCGTCGCCGTCAACGTCGCCAGCGTCCGGGCCTATGGCGAGCTCGAGTACTGGCTG
AGCCTGCTGAAGGTCATCACCATCATGGTCTTCATTGTCGTCGGCATCGTCGTCAATGTCGGCGGCAATCTTGAA
GGCCGATATATCGGGGTCGAGAACTGGAGGCTTCCTGGTGGTCCCTTTGTCGGCGGCATTGGGGGTTTTGCCTCC
GTCTTTGTTACGGCCTCGTTTGCCTATGGTGGCACGGAGTCGATTGCCATCACCGCTGGCGAGACCAAGAACCCG
ACCAAGACGATGCCGCGCGTCGTCAAAAACGTCTTTTGGAGGATACTCTTCTTCTACATCTTGTCCGTCCTTCTC
ATCGGCCTCAACGTCCCCTATACGTATCCCAACCTCAGCTCCAAAAACACAAGCACGTCACCCTTCACTATCGTC
TTCCAGATGACAGGTGCGCGCGCCGCCGGCAGCGTCATCAACGCCGTCATCCTGACGAGCGTCCTGTCGGCCGGA
AACCATGCGTTGTTCGCCGCCGGTCGGCTGCTGTACACGCTGGCGGCCGAGGGCCATGCGCCTCGGGCCTTTGCA
AGGCTTGGCAAGAACCAGGTGCCGTGGGTAGCGGTGCTCACTTCAGCATTCATCGCTGGTCTCTGCTTTGCCTCG
AGCTTTATCGGGGCTGGCCAGTTGTGGACTTGGCTGCAAAACATCGTCGGCGTCTCTAACCAGCTCAGCTGGATC
GCCATCGGCATAGCCTCGATACGTTTCCGTTCAGGCCTCGAGCGCCAGGGGAAGACGCGTCTGCTACCCTTTCGC
AACTGGACTTACCCCTGGGGTCCCTGGGCCGTCGTCATCCTCAACAGCTTCTTGGTGCTCATACAGGGATGGCGC
TGCTTCACGCCCAGGTTCGACCCCGTCAGCTTCGTGAGCTTCTACATTGAGCTGCCGATCATGCTGGTCATGTAC
ATTGGCTGGAAGGTCTGGCGGCGCACTAAGCTGGTTGGCTTGGATGAGATGGACCTCGAGACGGATGTGCATACG
GCGGACGAGGAGCCGTTGGAGGCGGCGGACAAGAATTGGAGGGCCAGAGTCAAGCGCGTCGCCGACTGGTTGTTT
Transcript >Ophio5|1226
ATGAAAGAATCGCCGGCGTCGGCACACGAGGCCGTCGCATTCACGCACGCCGAATCTGCCCCCATGAGCGCAATA
CACGATGATGAAAAATCAGCTGAGAAGCGCGAAGAACGACGCGATGATGATGGCGAGGGCCTCGTCTTCGTCCGT
TCGGACCGGCTGAGGCGCTCGCTATCGGCGCGACAAGTTCAGATGATTGCCATCGGCGGCACCATCGGCACCGGC
CTGTTTCTCGGATCCGGAAAATCGCTGGCGACGGGAGGGCCGGCGTCGATGTTGTTGTGCTACGCTATTGTCGGC
GCTATCGTTTTTGTCACGATGCTGAGCTTGGGGGAGATGTCGGCCTTTGTGCCCGTCGCCGGCAGCTTTTGCTCT
TTTTCTGGCCGCTTCGTCGACGACGCCTTCGGCTTCGCCCTCACCTGGAACTACTGGTTCAACGATGCGGTGTCG
ACCGCGTCGGACCTCGTCGCCCTACAGCTTGTGCTGCAGTATTGGACCGACCGATTCCCCGGCTGGGCGCTGAGT
CTCATCTTCTGGGCCCTTCTCGTCGCCGTCAACGTCGCCAGCGTCCGGGCCTATGGCGAGCTCGAGTACTGGCTG
AGCCTGCTGAAGGTCATCACCATCATGGTCTTCATTGTCGTCGGCATCGTCGTCAATGTCGGCGGCAATCTTGAA
GGCCGATATATCGGGGTCGAGAACTGGAGGCTTCCTGGTGGTCCCTTTGTCGGCGGCATTGGGGGTTTTGCCTCC
GTCTTTGTTACGGCCTCGTTTGCCTATGGTGGCACGGAGTCGATTGCCATCACCGCTGGCGAGACCAAGAACCCG
ACCAAGACGATGCCGCGCGTCGTCAAAAACGTCTTTTGGAGGATACTCTTCTTCTACATCTTGTCCGTCCTTCTC
ATCGGCCTCAACGTCCCCTATACGTATCCCAACCTCAGCTCCAAAAACACAAGCACGTCACCCTTCACTATCGTC
TTCCAGATGACAGGTGCGCGCGCCGCCGGCAGCGTCATCAACGCCGTCATCCTGACGAGCGTCCTGTCGGCCGGA
AACCATGCGTTGTTCGCCGCCGGTCGGCTGCTGTACACGCTGGCGGCCGAGGGCCATGCGCCTCGGGCCTTTGCA
AGGCTTGGCAAGAACCAGGTGCCGTGGGTAGCGGTGCTCACTTCAGCATTCATCGCTGGTCTCTGCTTTGCCTCG
AGCTTTATCGGGGCTGGCCAGTTGTGGACTTGGCTGCAAAACATCGTCGGCGTCTCTAACCAGCTCAGCTGGATC
GCCATCGGCATAGCCTCGATACGTTTCCGTTCAGGCCTCGAGCGCCAGGGGAAGACGCGTCTGCTACCCTTTCGC
AACTGGACTTACCCCTGGGGTCCCTGGGCCGTCGTCATCCTCAACAGCTTCTTGGTGCTCATACAGGGATGGCGC
TGCTTCACGCCCAGGTTCGACCCCGTCAGCTTCGTGAGCTTCTACATTGAGCTGCCGATCATGCTGGTCATGTAC
ATTGGCTGGAAGGTCTGGCGGCGCACTAAGCTGGTTGGCTTGGATGAGATGGACCTCGAGACGGATGTGCATACG
GCGGACGAGGAGCCGTTGGAGGCGGCGGACAAGAATTGGAGGGCCAGAGTCAAGCGCGTCGCCGACTGGTTGTTT
TGA
Gene >Ophio5|1226
ATGAAAGAATCGCCGGCGTCGGCACACGAGGCCGTCGCATTCACGCACGCCGAATCTGCCCCCATGAGCGCAATA
CACGATGATGAAAAATCAGCTGAGAAGCGCGAAGAACGACGCGATGATGATGGCGAGGGCCTCGTCTTCGTCCGT
TCGGACCGGCTGAGGCGCTCGCTATCGGCGCGACAAGTTCAGATGATTGCCATCGGCGGCACCATCGGCACCGGC
CTGTTTCTCGGATCCGGAAAATCGCTGGCGACGGGAGGGCCGGCGTCGATGTTGTTGTGCTACGCTATTGTCGGC
GCTATCGTTTTTGTCACGATGCTGAGCTTGGGGGAGATGTCGGCCTTTGTGCCCGTCGCCGGCAGCTTTTGCTCT
TTTTCTGGGTGGGTGTTCTGCGTGCGCCTCCACAAGGGATTGTGAGAGAGGCAGAGAGAGAGAGAGGGTGGACAA
GACGGTGGAGAGAATAAAAACAGAGAATGCTGACACGGCCCGCTGGCCAGCCGCTTCGTCGACGACGCCTTCGGC
TTCGCCCTCACCTGGAACTACTGGTTCAACGATGCGGTGTCGACCGCGTCGGACCTCGTCGCCCTACAGCTTGTG
CTGCAGTATTGGACCGACCGATTCCCCGGCTGGGCGCTGAGTCTCATCTTCTGGGCCCTTCTCGTCGCCGTCAAC
GTCGCCAGCGTCCGGGCCTATGGCGAGCTCGAGTACTGGCTGAGCCTGCTGAAGGTCATCACCATCATGGTGCGT
TGTCGTCTTCGTTGTCGTCGCCGCCACGTCCGCGGCTCACCCGTCATAGGTCTTCATTGTCGTCGGCATCGTCGT
CAATGTCGGCGGCAATCTTGAAGGCCGATATATCGGGGTCGAGAACTGGAGGCTTCCTGGTGGTCCCTTTGTCGG
CGGCATTGGGGGTTTTGCCTCCGTCTTTGTTACGGCCTCGTTTGCCTGCAAGTCGCATCCCTCTTCAGGACTGTA
TGTGCGATTCCTGACGGTCAGCGCTCTCAGATGGTGGCACGGAGTCGATTGCCATCACCGCTGGCGAGACCAAGA
ACCCGACCAAGACGATGCCGCGCGTCGTCAAAAACGTCTTTTGGAGGATACTCTTCTTCTAGTGGGTCTCATCAC
CGGATAGTTGTTTCCCACCGTCAAGTTGACGACATTCGCAGCATCTTGTCCGTCCTTCTCATCGGCCTCAACGTC
CCCTATACGTATCCCAACCTCAGCTCCAAAAACACAAGCACGTCACCCTTCACTATCGTCTTCCAGATGACAGGT
GCGCGCGCCGCCGGCAGCGTCATCAACGCCGTCATCCTGACGAGCGTCCTGTCGGCCGGAAACCATGCGTTGTTC
GCCGCCGGTCGGCTGCTGTACACGCTGGCGGCCGAGGGCCATGCGCCTCGGGCCTTTGCAAGGCTTGGCAAGAAC
CAGGTGCCGTGGGTAGCGGTGCTCACTTCAGCATTCATCGCTGGTCTCTGCTTTGCCTCGAGCTTTATCGGGGCT
GGCCAGTTGTGGACTTGGCTGCAAAAGTAGGTGACGATGGACCTGACAAGGGGGGGAAGGAAGGGGAGGGGAATG
GTATTCTGATGGGACAAACAGCATCGTCGGCGTCTCTAACCAGCTCAGCTGGATCGCCATCGGCATAGCCTCGAT
ACGTTTCCGTTCAGGCCTCGAGCGCCAGGGGAAGACGCGTCTGCTACCCTTTCGCAACTGGACTTACCCCTGGGG
TCCCTGGGCCGTCGTCATCCTCAACAGCTTCTTGGTGCTCATACAGGGATGGCGCTGCTTCACGCCCAGGTTCGA
CCCCGTCAGCTTCGTGAGCTTCTACATTGAGCTGCCGATCATGCTGGTCATGTACATTGGCTGGAAGGTCTGGCG
GCGCACTAAGCTGGTTGGCTTGGATGAGATGGACCTCGAGACGGATGTGCATACGGCGGACGAGGAGCCGTTGGA
GGCGGCGGACAAGAATTGGAGGGCCAGAGTCAAGCGCGTCGCCGACTGGTTGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail