Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1226
Gene name
Locationscaffold_14:43307..45315
Strand-
Gene length (bp)2008
Transcript length (bp)1653
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 1.6E-128 63 510
PF13520 AA_permease_2 Amino acid permease 7.4E-35 58 471

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0V0|YQD2_SCHPO Probable amino-acid permease PB1C11.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.02 PE=3 SV=1 52 522 6.0E-159
sp|P25737|LYSP_ECOLI Lysine-specific permease OS=Escherichia coli (strain K12) GN=lysP PE=1 SV=5 54 522 2.0E-130
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 40 539 1.0E-102
sp|O60170|MEU22_SCHPO Probable amino-acid permease meu22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu22 PE=2 SV=1 3 532 2.0E-102
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 26 540 2.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0V0|YQD2_SCHPO Probable amino-acid permease PB1C11.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.02 PE=3 SV=1 52 522 6.0E-159
sp|P25737|LYSP_ECOLI Lysine-specific permease OS=Escherichia coli (strain K12) GN=lysP PE=1 SV=5 54 522 2.0E-130
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 40 539 1.0E-102
sp|O60170|MEU22_SCHPO Probable amino-acid permease meu22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu22 PE=2 SV=1 3 532 2.0E-102
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 26 540 2.0E-102
sp|P25376|AGP1_YEAST General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP1 PE=1 SV=3 23 548 3.0E-100
sp|Q9P768|YI26_SCHPO Uncharacterized amino-acid permease P7G5.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP7G5.06 PE=3 SV=1 15 533 1.0E-99
sp|A6ZTG5|AGP1_YEAS7 General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=AGP1 PE=3 SV=1 23 548 2.0E-99
sp|Q876K6|AGP1_SACU7 General amino acid permease AGP1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AGP1 PE=3 SV=1 2 548 2.0E-99
sp|Q9URZ4|CAT1_SCHPO Cationic amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cat1 PE=1 SV=3 27 539 6.0E-97
sp|P38971|ALP1_YEAST Basic amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALP1 PE=1 SV=2 25 549 2.0E-94
sp|Q9P5N2|AAT1_SCHPO Amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aat1 PE=3 SV=1 39 541 1.0E-93
sp|B5BP45|YP51_SCHPO Uncharacterized amino-acid permease C460.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.01c PE=3 SV=1 22 545 5.0E-93
sp|P53388|DIP5_YEAST Dicarboxylic amino acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP5 PE=1 SV=1 39 543 2.0E-92
sp|Q9P5N4|YH81_SCHPO Uncharacterized amino-acid permease C359.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC359.01 PE=3 SV=2 2 540 3.0E-92
sp|P06775|HIP1_YEAST Histidine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIP1 PE=1 SV=2 1 527 2.0E-90
sp|P19145|GAP1_YEAST General amino-acid permease GAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAP1 PE=1 SV=2 54 548 2.0E-88
sp|O59831|YCUB_SCHPO Uncharacterized amino-acid permease C965.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.11c PE=3 SV=1 50 542 4.0E-88
sp|O74543|YCV4_SCHPO Uncharacterized amino-acid permease C777.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.04 PE=3 SV=1 30 520 1.0E-87
sp|P48813|GNP1_YEAST High-affinity glutamine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GNP1 PE=1 SV=2 50 548 3.0E-86
sp|P41815|BAP3_YEAST Valine amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP3 PE=1 SV=2 16 544 6.0E-85
sp|P18696|PUTX_EMENI Proline-specific permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prnB PE=2 SV=2 55 542 1.0E-84
sp|P38084|BAP2_YEAST Leu/Val/Ile amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP2 PE=1 SV=2 7 546 3.0E-84
sp|P15380|PUT4_YEAST Proline-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT4 PE=2 SV=2 1 532 3.0E-84
sp|Q9URZ3|PUT4_SCHPO Probable proline-specific permease put4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=put4 PE=3 SV=1 27 544 1.0E-83
sp|P38967|TAT2_YEAST Tryptophan permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT2 PE=1 SV=1 51 537 8.0E-83
sp|P34054|INDA1_HYPAT Amino-acid permease inda1 OS=Hypocrea atroviridis GN=inda1 PE=2 SV=1 38 548 2.0E-81
sp|P43059|CAN1_CANAW Lysine/arginine permease OS=Candida albicans (strain WO-1) GN=CAN1 PE=3 SV=2 53 538 7.0E-81
sp|P40901|ISP5_SCHPO Sexual differentiation process putative amino-acid permease isp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp5 PE=2 SV=2 50 536 1.0E-80
sp|Q9HDV2|YHE1_SCHPO Uncharacterized amino-acid permease PB2B2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.01 PE=3 SV=1 35 549 2.0E-80
sp|P43548|AGP3_YEAST General amino acid permease AGP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP3 PE=1 SV=1 40 539 1.0E-78
sp|P39137|ROCE_BACSU Amino-acid permease RocE OS=Bacillus subtilis (strain 168) GN=rocE PE=2 SV=1 52 519 2.0E-76
sp|P38090|AGP2_YEAST General amino acid permease AGP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP2 PE=1 SV=1 16 543 4.0E-76
sp|P39636|ROCC_BACSU Amino-acid permease RocC OS=Bacillus subtilis (strain 168) GN=rocC PE=2 SV=1 50 500 4.0E-74
sp|P38085|TAT1_YEAST Valine/tyrosine/tryptophan amino-acid permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT1 PE=1 SV=1 2 536 6.0E-74
sp|P42087|HUTM_BACSU Putative histidine permease OS=Bacillus subtilis (strain 168) GN=hutM PE=3 SV=2 51 522 2.0E-72
sp|Q8FL49|AROP_ECOL6 Aromatic amino acid transport protein AroP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroP PE=3 SV=1 50 509 2.0E-72
sp|P59737|AROP_SHIFL Aromatic amino acid transport protein AroP OS=Shigella flexneri GN=aroP PE=3 SV=1 50 509 7.0E-72
sp|P15993|AROP_ECOLI Aromatic amino acid transport protein AroP OS=Escherichia coli (strain K12) GN=aroP PE=1 SV=3 50 509 1.0E-71
sp|P46349|GABP_BACSU GABA permease OS=Bacillus subtilis (strain 168) GN=gabP PE=1 SV=3 54 463 1.0E-71
sp|Q8X968|AROP_ECO57 Aromatic amino acid transport protein AroP OS=Escherichia coli O157:H7 GN=aroP PE=3 SV=1 50 472 2.0E-71
sp|Q12372|MMP1_YEAST S-methylmethionine permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMP1 PE=1 SV=1 55 529 5.0E-71
sp|Q92367|AAP1_SCHPO Amino-acid permease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aap1 PE=3 SV=1 46 450 8.0E-71
sp|O34618|YTNA_BACSU Uncharacterized amino acid permease YtnA OS=Bacillus subtilis (strain 168) GN=ytnA PE=3 SV=1 50 479 2.0E-70
sp|P27837|YIFK_ECOLI Probable transport protein YifK OS=Escherichia coli (strain K12) GN=yifK PE=1 SV=4 50 516 4.0E-70
sp|P24207|PHEP_ECOLI Phenylalanine-specific permease OS=Escherichia coli (strain K12) GN=pheP PE=1 SV=1 50 508 5.0E-70
sp|P0CK99|AROP_SALTY Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroP PE=3 SV=1 50 457 6.0E-69
sp|E1W822|AROP_SALTS Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain SL1344) GN=aroP PE=3 SV=1 50 457 6.0E-69
sp|P0A188|AROP_SALTI Aromatic amino acid transport protein AroP OS=Salmonella typhi GN=aroP PE=3 SV=1 50 457 6.0E-69
sp|Q47689|MMUP_ECOLI Probable S-methylmethionine permease OS=Escherichia coli (strain K12) GN=mmuP PE=3 SV=2 50 500 9.0E-69
sp|P96704|YDGF_BACSU Uncharacterized transporter YdgF OS=Bacillus subtilis (strain 168) GN=ydgF PE=3 SV=1 49 452 7.0E-68
sp|P0A189|YIFK_SALTY Probable transport protein YifK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yifK PE=3 SV=1 50 456 1.0E-67
sp|P0A190|YIFK_SALTI Probable transport protein YifK OS=Salmonella typhi GN=yifK PE=3 SV=1 50 456 1.0E-67
sp|Q08986|SAM3_YEAST S-adenosylmethionine permease SAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM3 PE=1 SV=1 18 536 7.0E-67
sp|P9WQM7|ANSP2_MYCTU L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP2 PE=1 SV=1 36 527 1.0E-66
sp|P9WQM6|ANSP2_MYCTO L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP2 PE=3 SV=1 36 527 1.0E-66
sp|P0A4W1|ANSP2_MYCBO L-asparagine permease 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP2 PE=3 SV=1 36 527 1.0E-66
sp|O31462|YBGF_BACSU Uncharacterized amino acid permease YbgF OS=Bacillus subtilis (strain 168) GN=ybgF PE=3 SV=1 54 508 2.0E-65
sp|P0AAE0|CYCA_ECOLI D-serine/D-alanine/glycine transporter OS=Escherichia coli (strain K12) GN=cycA PE=1 SV=1 51 383 4.0E-64
sp|P0AAE1|CYCA_ECO57 D-serine/D-alanine/glycine transporter OS=Escherichia coli O157:H7 GN=cycA PE=3 SV=1 51 383 4.0E-64
sp|P37460|PROY_SALTY Proline-specific permease ProY OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proY PE=3 SV=3 51 508 1.0E-62
sp|Q46065|AROP_CORGL Aromatic amino acid transport protein AroP OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aroP PE=3 SV=1 51 456 7.0E-62
sp|P77610|ANSP_ECOLI L-asparagine permease OS=Escherichia coli (strain K12) GN=ansP PE=3 SV=2 26 459 5.0E-60
sp|P0AAE2|PROY_ECOLI Proline-specific permease ProY OS=Escherichia coli (strain K12) GN=proY PE=1 SV=1 51 508 2.0E-59
sp|P0AAE3|PROY_ECOL6 Proline-specific permease ProY OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=proY PE=3 SV=1 51 508 2.0E-59
sp|P0AAE4|PROY_ECO57 Proline-specific permease ProY OS=Escherichia coli O157:H7 GN=proY PE=3 SV=1 51 508 2.0E-59
sp|P25527|GABP_ECOLI GABA permease OS=Escherichia coli (strain K12) GN=gabP PE=1 SV=1 50 475 4.0E-59
sp|O06005|AAPA_BACSU Amino-acid permease AapA OS=Bacillus subtilis (strain 168) GN=aapA PE=3 SV=2 48 471 1.0E-58
sp|P54425|YBXG_BACSU Uncharacterized transporter YbxG OS=Bacillus subtilis (strain 168) GN=ybxG PE=3 SV=2 51 510 2.0E-58
sp|P40812|ANSP_SALTY L-asparagine permease OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ansP PE=3 SV=1 26 459 2.0E-58
sp|P9WQM9|ANSP1_MYCTU L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP1 PE=1 SV=1 55 453 4.0E-57
sp|P9WQM8|ANSP1_MYCTO L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP1 PE=3 SV=1 55 453 4.0E-57
sp|Q7VEQ4|ANSP1_MYCBO L-asparagine permease 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP1 PE=3 SV=1 36 453 1.0E-56
sp|Q03770|SSY1_YEAST SPS-sensor component SSY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSY1 PE=1 SV=1 49 549 8.0E-53
sp|Q9X7P0|ANSP_STRCO L-asparagine permease OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ansP PE=3 SV=1 56 473 8.0E-53
sp|Q9I703|BAUD_PSEAE Probable GABA permease OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bauD PE=2 SV=1 50 463 3.0E-52
sp|O32257|YVBW_BACSU Uncharacterized amino acid permease YvbW OS=Bacillus subtilis (strain 168) GN=yvbW PE=2 SV=1 51 469 1.0E-51
sp|P45495|YPEV_LACDL Uncharacterized transporter in pepV 3'region (Fragment) OS=Lactobacillus delbrueckii subsp. lactis PE=3 SV=1 50 216 3.0E-28
sp|P94383|YCGH_BACSU Uncharacterized transporter YcgH OS=Bacillus subtilis (strain 168) GN=ycgH PE=3 SV=3 50 446 9.0E-28
sp|Q797A7|YFNA_BACSU Uncharacterized amino acid permease YfnA OS=Bacillus subtilis (strain 168) GN=yfnA PE=3 SV=1 50 449 1.0E-17
sp|A8I499|CTR2_PIG Cationic amino acid transporter 2 OS=Sus scrofa GN=SLC7A2 PE=2 SV=1 49 396 2.0E-12
sp|Q8GYB4|CAAT3_ARATH Cationic amino acid transporter 3, mitochondrial OS=Arabidopsis thaliana GN=CAT3 PE=2 SV=1 30 434 2.0E-12
sp|Q9ASS7|CAAT2_ARATH Cationic amino acid transporter 2, vacuolar OS=Arabidopsis thaliana GN=CAT2 PE=2 SV=1 30 434 5.0E-12
sp|Q45577|YBEC_BACSU Probable amino acid-proton symporter YbeC OS=Bacillus subtilis (strain 168) GN=ybeC PE=3 SV=3 52 502 8.0E-12
sp|B5D5N9|CTR2_RAT Cationic amino acid transporter 2 OS=Rattus norvegicus GN=Slc7a2 PE=1 SV=1 49 396 3.0E-11
sp|Q8X845|FRLA_ECO57 Putative fructoselysine transporter FrlA OS=Escherichia coli O157:H7 GN=frlA PE=3 SV=2 51 283 3.0E-11
sp|P45539|FRLA_ECOLI Putative fructoselysine transporter FrlA OS=Escherichia coli (strain K12) GN=frlA PE=3 SV=2 51 283 6.0E-11
sp|P52569|CTR2_HUMAN Cationic amino acid transporter 2 OS=Homo sapiens GN=SLC7A2 PE=1 SV=2 49 396 6.0E-11
sp|B3TP03|CTR2_CHICK Cationic amino acid transporter 2 OS=Gallus gallus GN=SLC7A2 PE=2 SV=1 38 396 9.0E-11
sp|P18581|CTR2_MOUSE Cationic amino acid transporter 2 OS=Mus musculus GN=Slc7a2 PE=1 SV=3 49 396 1.0E-10
sp|Q9WVR6|LAT2_RAT Large neutral amino acids transporter small subunit 2 OS=Rattus norvegicus GN=Slc7a8 PE=1 SV=1 26 422 6.0E-10
sp|Q6DCE8|CTR2_XENLA Cationic amino acid transporter 2 OS=Xenopus laevis GN=slc7a2 PE=2 SV=1 35 396 7.0E-10
sp|Q8W4K3|CAAT4_ARATH Cationic amino acid transporter 4, vacuolar OS=Arabidopsis thaliana GN=CAT4 PE=2 SV=1 39 435 9.0E-10
sp|O07576|YHDG_BACSU Uncharacterized amino acid permease YhdG OS=Bacillus subtilis (strain 168) GN=yhdG PE=2 SV=1 52 500 3.0E-09
sp|Q5RAE3|LAT2_PONAB Large neutral amino acids transporter small subunit 2 OS=Pongo abelii GN=SLC7A8 PE=2 SV=2 54 422 1.0E-08
sp|Q9UHI5|LAT2_HUMAN Large neutral amino acids transporter small subunit 2 OS=Homo sapiens GN=SLC7A8 PE=1 SV=1 54 422 1.0E-08
sp|P70423|CTR3_MOUSE Cationic amino acid transporter 3 OS=Mus musculus GN=Slc7a3 PE=2 SV=1 53 395 1.0E-08
sp|Q9QXW9|LAT2_MOUSE Large neutral amino acids transporter small subunit 2 OS=Mus musculus GN=Slc7a8 PE=1 SV=1 27 422 1.0E-08
sp|O43246|CTR4_HUMAN Cationic amino acid transporter 4 OS=Homo sapiens GN=SLC7A4 PE=2 SV=3 54 383 2.0E-08
sp|O08812|CTR3_RAT Cationic amino acid transporter 3 OS=Rattus norvegicus GN=Slc7a3 PE=2 SV=1 53 394 3.0E-08
sp|Q8WY07|CTR3_HUMAN Cationic amino acid transporter 3 OS=Homo sapiens GN=SLC7A3 PE=1 SV=1 53 444 3.0E-08
sp|Q9N1Q4|LAT2_RABIT Large neutral amino acids transporter small subunit 2 OS=Oryctolagus cuniculus GN=SLC7A8 PE=1 SV=1 26 422 4.0E-08
sp|Q8BLQ7|CTR4_MOUSE Cationic amino acid transporter 4 OS=Mus musculus GN=Slc7a4 PE=1 SV=1 54 388 6.0E-08
sp|B0UYF2|S7A14_DANRE Probable cationic amino acid transporter OS=Danio rerio GN=slc7a14a PE=3 SV=1 53 392 6.0E-08
sp|Q9QXA6|BAT1_MOUSE b(0,+)-type amino acid transporter 1 OS=Mus musculus GN=Slc7a9 PE=1 SV=1 28 382 2.0E-07
sp|Q5PR34|CTR2_DANRE Cationic amino acid transporter 2 OS=Danio rerio GN=slc7a2 PE=2 SV=1 38 383 3.0E-07
sp|Q9N1R6|BAT1_RABIT b(0,+)-type amino acid transporter 1 OS=Oryctolagus cuniculus GN=SLC7A9 PE=1 SV=1 33 470 4.0E-07
sp|P30823|CTR1_RAT High affinity cationic amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a1 PE=2 SV=1 50 396 4.0E-07
sp|O64759|CAAT5_ARATH Cationic amino acid transporter 5 OS=Arabidopsis thaliana GN=CAT5 PE=1 SV=1 37 332 7.0E-07
sp|Q8TBB6|S7A14_HUMAN Probable cationic amino acid transporter OS=Homo sapiens GN=SLC7A14 PE=2 SV=3 53 392 8.0E-07
sp|Q92536|YLAT2_HUMAN Y+L amino acid transporter 2 OS=Homo sapiens GN=SLC7A6 PE=1 SV=3 23 371 1.0E-06
sp|Q09143|CTR1_MOUSE High affinity cationic amino acid transporter 1 OS=Mus musculus GN=Slc7a1 PE=1 SV=1 50 396 2.0E-06
sp|A0JNI9|S7A14_BOVIN Probable cationic amino acid transporter OS=Bos taurus GN=SLC7A14 PE=2 SV=1 42 392 3.0E-06
sp|P30825|CTR1_HUMAN High affinity cationic amino acid transporter 1 OS=Homo sapiens GN=SLC7A1 PE=1 SV=1 53 396 4.0E-06
sp|P82252|BAT1_RAT b(0,+)-type amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a9 PE=1 SV=1 28 382 4.0E-06
sp|Q8BXR1|S7A14_MOUSE Probable cationic amino acid transporter OS=Mus musculus GN=Slc7a14 PE=1 SV=1 42 392 8.0E-06
sp|Q8TCU3|S7A13_HUMAN Solute carrier family 7 member 13 OS=Homo sapiens GN=SLC7A13 PE=2 SV=1 72 388 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 63 85 22
2 92 111 19
3 171 193 22
4 200 222 22
5 237 259 22
6 286 308 22
7 328 350 22
8 382 404 22
9 409 431 22
10 452 474 22
11 484 506 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1226
MKESPASAHEAVAFTHAESAPMSAIHDDEKSAEKREERRDDDGEGLVFVRSDRLRRSLSARQVQMIAIGGTIGTG
LFLGSGKSLATGGPASMLLCYAIVGAIVFVTMLSLGEMSAFVPVAGSFCSFSGRFVDDAFGFALTWNYWFNDAVS
TASDLVALQLVLQYWTDRFPGWALSLIFWALLVAVNVASVRAYGELEYWLSLLKVITIMVFIVVGIVVNVGGNLE
GRYIGVENWRLPGGPFVGGIGGFASVFVTASFAYGGTESIAITAGETKNPTKTMPRVVKNVFWRILFFYILSVLL
IGLNVPYTYPNLSSKNTSTSPFTIVFQMTGARAAGSVINAVILTSVLSAGNHALFAAGRLLYTLAAEGHAPRAFA
RLGKNQVPWVAVLTSAFIAGLCFASSFIGAGQLWTWLQNIVGVSNQLSWIAIGIASIRFRSGLERQGKTRLLPFR
NWTYPWGPWAVVILNSFLVLIQGWRCFTPRFDPVSFVSFYIELPIMLVMYIGWKVWRRTKLVGLDEMDLETDVHT
ADEEPLEAADKNWRARVKRVADWLF
Coding >Ophio5|1226
ATGAAAGAATCGCCGGCGTCGGCACACGAGGCCGTCGCATTCACGCACGCCGAATCTGCCCCCATGAGCGCAATA
CACGATGATGAAAAATCAGCTGAGAAGCGCGAAGAACGACGCGATGATGATGGCGAGGGCCTCGTCTTCGTCCGT
TCGGACCGGCTGAGGCGCTCGCTATCGGCGCGACAAGTTCAGATGATTGCCATCGGCGGCACCATCGGCACCGGC
CTGTTTCTCGGATCCGGAAAATCGCTGGCGACGGGAGGGCCGGCGTCGATGTTGTTGTGCTACGCTATTGTCGGC
GCTATCGTTTTTGTCACGATGCTGAGCTTGGGGGAGATGTCGGCCTTTGTGCCCGTCGCCGGCAGCTTTTGCTCT
TTTTCTGGCCGCTTCGTCGACGACGCCTTCGGCTTCGCCCTCACCTGGAACTACTGGTTCAACGATGCGGTGTCG
ACCGCGTCGGACCTCGTCGCCCTACAGCTTGTGCTGCAGTATTGGACCGACCGATTCCCCGGCTGGGCGCTGAGT
CTCATCTTCTGGGCCCTTCTCGTCGCCGTCAACGTCGCCAGCGTCCGGGCCTATGGCGAGCTCGAGTACTGGCTG
AGCCTGCTGAAGGTCATCACCATCATGGTCTTCATTGTCGTCGGCATCGTCGTCAATGTCGGCGGCAATCTTGAA
GGCCGATATATCGGGGTCGAGAACTGGAGGCTTCCTGGTGGTCCCTTTGTCGGCGGCATTGGGGGTTTTGCCTCC
GTCTTTGTTACGGCCTCGTTTGCCTATGGTGGCACGGAGTCGATTGCCATCACCGCTGGCGAGACCAAGAACCCG
ACCAAGACGATGCCGCGCGTCGTCAAAAACGTCTTTTGGAGGATACTCTTCTTCTACATCTTGTCCGTCCTTCTC
ATCGGCCTCAACGTCCCCTATACGTATCCCAACCTCAGCTCCAAAAACACAAGCACGTCACCCTTCACTATCGTC
TTCCAGATGACAGGTGCGCGCGCCGCCGGCAGCGTCATCAACGCCGTCATCCTGACGAGCGTCCTGTCGGCCGGA
AACCATGCGTTGTTCGCCGCCGGTCGGCTGCTGTACACGCTGGCGGCCGAGGGCCATGCGCCTCGGGCCTTTGCA
AGGCTTGGCAAGAACCAGGTGCCGTGGGTAGCGGTGCTCACTTCAGCATTCATCGCTGGTCTCTGCTTTGCCTCG
AGCTTTATCGGGGCTGGCCAGTTGTGGACTTGGCTGCAAAACATCGTCGGCGTCTCTAACCAGCTCAGCTGGATC
GCCATCGGCATAGCCTCGATACGTTTCCGTTCAGGCCTCGAGCGCCAGGGGAAGACGCGTCTGCTACCCTTTCGC
AACTGGACTTACCCCTGGGGTCCCTGGGCCGTCGTCATCCTCAACAGCTTCTTGGTGCTCATACAGGGATGGCGC
TGCTTCACGCCCAGGTTCGACCCCGTCAGCTTCGTGAGCTTCTACATTGAGCTGCCGATCATGCTGGTCATGTAC
ATTGGCTGGAAGGTCTGGCGGCGCACTAAGCTGGTTGGCTTGGATGAGATGGACCTCGAGACGGATGTGCATACG
GCGGACGAGGAGCCGTTGGAGGCGGCGGACAAGAATTGGAGGGCCAGAGTCAAGCGCGTCGCCGACTGGTTGTTT
Transcript >Ophio5|1226
ATGAAAGAATCGCCGGCGTCGGCACACGAGGCCGTCGCATTCACGCACGCCGAATCTGCCCCCATGAGCGCAATA
CACGATGATGAAAAATCAGCTGAGAAGCGCGAAGAACGACGCGATGATGATGGCGAGGGCCTCGTCTTCGTCCGT
TCGGACCGGCTGAGGCGCTCGCTATCGGCGCGACAAGTTCAGATGATTGCCATCGGCGGCACCATCGGCACCGGC
CTGTTTCTCGGATCCGGAAAATCGCTGGCGACGGGAGGGCCGGCGTCGATGTTGTTGTGCTACGCTATTGTCGGC
GCTATCGTTTTTGTCACGATGCTGAGCTTGGGGGAGATGTCGGCCTTTGTGCCCGTCGCCGGCAGCTTTTGCTCT
TTTTCTGGCCGCTTCGTCGACGACGCCTTCGGCTTCGCCCTCACCTGGAACTACTGGTTCAACGATGCGGTGTCG
ACCGCGTCGGACCTCGTCGCCCTACAGCTTGTGCTGCAGTATTGGACCGACCGATTCCCCGGCTGGGCGCTGAGT
CTCATCTTCTGGGCCCTTCTCGTCGCCGTCAACGTCGCCAGCGTCCGGGCCTATGGCGAGCTCGAGTACTGGCTG
AGCCTGCTGAAGGTCATCACCATCATGGTCTTCATTGTCGTCGGCATCGTCGTCAATGTCGGCGGCAATCTTGAA
GGCCGATATATCGGGGTCGAGAACTGGAGGCTTCCTGGTGGTCCCTTTGTCGGCGGCATTGGGGGTTTTGCCTCC
GTCTTTGTTACGGCCTCGTTTGCCTATGGTGGCACGGAGTCGATTGCCATCACCGCTGGCGAGACCAAGAACCCG
ACCAAGACGATGCCGCGCGTCGTCAAAAACGTCTTTTGGAGGATACTCTTCTTCTACATCTTGTCCGTCCTTCTC
ATCGGCCTCAACGTCCCCTATACGTATCCCAACCTCAGCTCCAAAAACACAAGCACGTCACCCTTCACTATCGTC
TTCCAGATGACAGGTGCGCGCGCCGCCGGCAGCGTCATCAACGCCGTCATCCTGACGAGCGTCCTGTCGGCCGGA
AACCATGCGTTGTTCGCCGCCGGTCGGCTGCTGTACACGCTGGCGGCCGAGGGCCATGCGCCTCGGGCCTTTGCA
AGGCTTGGCAAGAACCAGGTGCCGTGGGTAGCGGTGCTCACTTCAGCATTCATCGCTGGTCTCTGCTTTGCCTCG
AGCTTTATCGGGGCTGGCCAGTTGTGGACTTGGCTGCAAAACATCGTCGGCGTCTCTAACCAGCTCAGCTGGATC
GCCATCGGCATAGCCTCGATACGTTTCCGTTCAGGCCTCGAGCGCCAGGGGAAGACGCGTCTGCTACCCTTTCGC
AACTGGACTTACCCCTGGGGTCCCTGGGCCGTCGTCATCCTCAACAGCTTCTTGGTGCTCATACAGGGATGGCGC
TGCTTCACGCCCAGGTTCGACCCCGTCAGCTTCGTGAGCTTCTACATTGAGCTGCCGATCATGCTGGTCATGTAC
ATTGGCTGGAAGGTCTGGCGGCGCACTAAGCTGGTTGGCTTGGATGAGATGGACCTCGAGACGGATGTGCATACG
GCGGACGAGGAGCCGTTGGAGGCGGCGGACAAGAATTGGAGGGCCAGAGTCAAGCGCGTCGCCGACTGGTTGTTT
TGA
Gene >Ophio5|1226
ATGAAAGAATCGCCGGCGTCGGCACACGAGGCCGTCGCATTCACGCACGCCGAATCTGCCCCCATGAGCGCAATA
CACGATGATGAAAAATCAGCTGAGAAGCGCGAAGAACGACGCGATGATGATGGCGAGGGCCTCGTCTTCGTCCGT
TCGGACCGGCTGAGGCGCTCGCTATCGGCGCGACAAGTTCAGATGATTGCCATCGGCGGCACCATCGGCACCGGC
CTGTTTCTCGGATCCGGAAAATCGCTGGCGACGGGAGGGCCGGCGTCGATGTTGTTGTGCTACGCTATTGTCGGC
GCTATCGTTTTTGTCACGATGCTGAGCTTGGGGGAGATGTCGGCCTTTGTGCCCGTCGCCGGCAGCTTTTGCTCT
TTTTCTGGGTGGGTGTTCTGCGTGCGCCTCCACAAGGGATTGTGAGAGAGGCAGAGAGAGAGAGAGGGTGGACAA
GACGGTGGAGAGAATAAAAACAGAGAATGCTGACACGGCCCGCTGGCCAGCCGCTTCGTCGACGACGCCTTCGGC
TTCGCCCTCACCTGGAACTACTGGTTCAACGATGCGGTGTCGACCGCGTCGGACCTCGTCGCCCTACAGCTTGTG
CTGCAGTATTGGACCGACCGATTCCCCGGCTGGGCGCTGAGTCTCATCTTCTGGGCCCTTCTCGTCGCCGTCAAC
GTCGCCAGCGTCCGGGCCTATGGCGAGCTCGAGTACTGGCTGAGCCTGCTGAAGGTCATCACCATCATGGTGCGT
TGTCGTCTTCGTTGTCGTCGCCGCCACGTCCGCGGCTCACCCGTCATAGGTCTTCATTGTCGTCGGCATCGTCGT
CAATGTCGGCGGCAATCTTGAAGGCCGATATATCGGGGTCGAGAACTGGAGGCTTCCTGGTGGTCCCTTTGTCGG
CGGCATTGGGGGTTTTGCCTCCGTCTTTGTTACGGCCTCGTTTGCCTGCAAGTCGCATCCCTCTTCAGGACTGTA
TGTGCGATTCCTGACGGTCAGCGCTCTCAGATGGTGGCACGGAGTCGATTGCCATCACCGCTGGCGAGACCAAGA
ACCCGACCAAGACGATGCCGCGCGTCGTCAAAAACGTCTTTTGGAGGATACTCTTCTTCTAGTGGGTCTCATCAC
CGGATAGTTGTTTCCCACCGTCAAGTTGACGACATTCGCAGCATCTTGTCCGTCCTTCTCATCGGCCTCAACGTC
CCCTATACGTATCCCAACCTCAGCTCCAAAAACACAAGCACGTCACCCTTCACTATCGTCTTCCAGATGACAGGT
GCGCGCGCCGCCGGCAGCGTCATCAACGCCGTCATCCTGACGAGCGTCCTGTCGGCCGGAAACCATGCGTTGTTC
GCCGCCGGTCGGCTGCTGTACACGCTGGCGGCCGAGGGCCATGCGCCTCGGGCCTTTGCAAGGCTTGGCAAGAAC
CAGGTGCCGTGGGTAGCGGTGCTCACTTCAGCATTCATCGCTGGTCTCTGCTTTGCCTCGAGCTTTATCGGGGCT
GGCCAGTTGTGGACTTGGCTGCAAAAGTAGGTGACGATGGACCTGACAAGGGGGGGAAGGAAGGGGAGGGGAATG
GTATTCTGATGGGACAAACAGCATCGTCGGCGTCTCTAACCAGCTCAGCTGGATCGCCATCGGCATAGCCTCGAT
ACGTTTCCGTTCAGGCCTCGAGCGCCAGGGGAAGACGCGTCTGCTACCCTTTCGCAACTGGACTTACCCCTGGGG
TCCCTGGGCCGTCGTCATCCTCAACAGCTTCTTGGTGCTCATACAGGGATGGCGCTGCTTCACGCCCAGGTTCGA
CCCCGTCAGCTTCGTGAGCTTCTACATTGAGCTGCCGATCATGCTGGTCATGTACATTGGCTGGAAGGTCTGGCG
GCGCACTAAGCTGGTTGGCTTGGATGAGATGGACCTCGAGACGGATGTGCATACGGCGGACGAGGAGCCGTTGGA
GGCGGCGGACAAGAATTGGAGGGCCAGAGTCAAGCGCGTCGCCGACTGGTTGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail