Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1224
Gene name
Locationscaffold_14:37497..39663
Strand-
Gene length (bp)2166
Transcript length (bp)1920
Coding sequence length (bp)1917
Protein length (aa) 639

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 5.4E-22 225 372

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25502|PUT3_YEAST Proline utilization trans-activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT3 PE=1 SV=1 179 533 4.0E-35
sp|O14130|YF54_SCHPO Uncharacterized transcriptional regulatory protein C3C7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.04 PE=3 SV=1 126 607 1.0E-30
sp|O94490|YC79_SCHPO Uncharacterized transcriptional regulatory protein C417.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.09c PE=3 SV=1 182 553 1.0E-18
sp|P36598|THI1_SCHPO Thiamine repressible genes regulatory protein thi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi1 PE=1 SV=2 182 515 2.0E-15
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 116 419 1.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25502|PUT3_YEAST Proline utilization trans-activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT3 PE=1 SV=1 179 533 4.0E-35
sp|O14130|YF54_SCHPO Uncharacterized transcriptional regulatory protein C3C7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.04 PE=3 SV=1 126 607 1.0E-30
sp|O94490|YC79_SCHPO Uncharacterized transcriptional regulatory protein C417.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.09c PE=3 SV=1 182 553 1.0E-18
sp|P36598|THI1_SCHPO Thiamine repressible genes regulatory protein thi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi1 PE=1 SV=2 182 515 2.0E-15
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 116 419 1.0E-13
sp|O59744|YN28_SCHPO Uncharacterized transcriptional regulatory protein C530.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.08 PE=3 SV=1 216 414 1.0E-10
sp|P07272|PPR1_YEAST Pyrimidine pathway regulatory protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPR1 PE=1 SV=1 251 316 7.0E-08
sp|P04386|GAL4_YEAST Regulatory protein GAL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL4 PE=1 SV=2 215 478 1.0E-07
sp|Q59LV8|ASG1_CANAL Activator of stress genes protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASG1 PE=3 SV=1 185 409 2.0E-07
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 80 379 2.0E-07
sp|Q09922|YAKB_SCHPO Uncharacterized transcriptional regulatory protein C1F7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F7.11c PE=3 SV=1 155 461 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009059 macromolecule biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1224
MTCVYEGARKILVNESYLRQLEAKAKALDAAAVAAPPSAASASKRGPTDEEDEFADGQPLLEPFTQLNLERPSTS
FQGPASSDNFLRNVRKLYHDDDGGTSLDCWQANLYEPGALPGRTFGLRTRLPPVDTARRLFSAQHVYIGTIFAFT
EPLEAFEQMLGEAYGGPPDPRDREACLKYAKVLLVLAFGQLYSVNQWVGFRGPPGFDYFADSLGLLPETHEEGSL
GGVEALALAGYFMQNMNRRDAAFQYLGRALRMAVSLGLHLEMGDDEDEAGRERRRRVWWSVYSLDRILCVKSGNP
LTIQDDDIGVALPSRLPGEPEHGPASVLRDYTQLSRILGQIHDAVYRRSVPRSGRNLVAAVQTIVRALSRWFREL
PAVLRFEPQSFSRESVGTLAHYYQCINMTVRPLLLHVVERRLRAIRSGGPDEKERDWKAGLSQATVRVVEMGLGA
AHDTVNMMAIAAQRDMVATYGYMDGEHIFSASIVLVMACAAFPANAANTLAMQTGLGLLRYMGERGNSHMGARYE
LLASLHAGAGQALSSTSSSSPPLSPPVPVSASASASASLSSCAPAAVPEALAYFPAVDNSFLDEPLYDESGMDFG
LWEEGFACPTMDLDFDLAQRTSSTAGGNVNLSDLMYSHG
Coding >Ophio5|1224
ATGACGTGCGTGTACGAGGGCGCGAGGAAGATTCTGGTCAACGAGTCCTATTTGCGGCAGCTCGAGGCCAAGGCC
AAGGCCTTGGACGCAGCGGCGGTGGCGGCGCCGCCGTCGGCAGCTTCAGCATCGAAGCGAGGACCGACGGACGAA
GAGGACGAGTTTGCGGACGGTCAACCGCTACTGGAACCCTTTACCCAGTTGAACCTCGAGCGGCCATCGACGAGC
TTCCAGGGTCCCGCCTCGTCGGACAACTTCTTGCGCAACGTGCGCAAGCTCTACCACGACGACGATGGCGGCACC
AGCCTCGACTGCTGGCAGGCCAACCTGTACGAACCTGGGGCGCTGCCCGGACGGACGTTTGGGCTCCGTACGCGG
CTACCGCCGGTGGACACGGCGCGCCGGCTGTTCTCGGCGCAGCACGTCTATATCGGTACCATCTTCGCCTTTACG
GAGCCGCTCGAGGCGTTTGAGCAGATGCTGGGAGAGGCCTACGGTGGGCCGCCCGACCCGCGCGACCGTGAGGCC
TGCCTCAAATATGCCAAGGTGCTACTGGTGCTGGCCTTTGGGCAGCTCTACTCGGTCAACCAGTGGGTGGGCTTC
CGCGGCCCGCCGGGCTTCGACTACTTCGCCGACTCGCTCGGCCTGCTGCCGGAGACGCACGAGGAGGGCTCGCTT
GGCGGAGTCGAGGCGCTGGCGCTGGCAGGCTACTTCATGCAGAACATGAACCGGCGCGACGCCGCCTTCCAGTAC
CTCGGACGGGCCCTGCGCATGGCCGTGTCGCTCGGCCTCCACCTCGAGATGGGCGACGACGAAGACGAAGCCGGG
CGCGAGCGGCGGCGGCGCGTCTGGTGGTCCGTCTATAGCCTGGACCGCATATTGTGCGTCAAGTCGGGCAACCCG
CTGACGATCCAGGACGACGATATTGGGGTGGCGCTGCCGTCTCGGCTCCCGGGCGAACCGGAGCACGGGCCGGCG
TCGGTCCTGCGCGACTACACGCAGCTGTCGCGTATATTGGGCCAGATTCACGACGCCGTCTACCGTCGCTCAGTG
CCTCGCTCGGGCCGTAACCTAGTGGCCGCAGTGCAGACCATCGTCCGCGCCCTGTCGCGCTGGTTCCGCGAGCTG
CCGGCCGTGCTGCGGTTCGAGCCGCAGAGTTTCAGCCGCGAGAGCGTCGGCACCCTCGCCCACTACTACCAGTGC
ATCAACATGACGGTCCGTCCGTTGCTGCTGCACGTCGTCGAGCGTCGTCTGCGGGCCATCCGCTCCGGCGGACCG
GACGAGAAGGAGCGCGACTGGAAGGCCGGCCTGTCGCAGGCGACGGTGCGAGTCGTCGAGATGGGGCTGGGAGCC
GCCCACGATACGGTCAACATGATGGCCATTGCCGCCCAGCGGGACATGGTCGCCACCTACGGCTACATGGACGGC
GAGCACATCTTCTCGGCCTCCATCGTCCTCGTCATGGCCTGCGCCGCCTTCCCGGCCAACGCGGCCAACACGCTG
GCCATGCAGACGGGCCTAGGCCTCCTCCGCTACATGGGCGAGCGCGGCAACAGCCACATGGGCGCGCGCTACGAG
CTCCTGGCTTCGCTTCACGCGGGCGCGGGACAGGCCCTGTCGTCTACGTCGTCGTCGTCGCCGCCTCTCTCGCCT
CCGGTTCCGGTCTCGGCCTCGGCCTCGGCCTCGGCCTCGTTGTCGTCTTGTGCTCCCGCCGCCGTACCCGAGGCC
CTGGCATACTTCCCGGCCGTCGACAATAGCTTCCTGGACGAGCCTCTCTACGACGAGAGCGGGATGGATTTCGGC
CTTTGGGAGGAGGGCTTCGCCTGTCCGACTATGGATCTGGATTTCGATCTCGCTCAGAGGACTTCTTCGACGGCG
GGAGGCAATGTCAACCTATCTGATCTCATGTACAGCCACGGG
Transcript >Ophio5|1224
ATGACGTGCGTGTACGAGGGCGCGAGGAAGATTCTGGTCAACGAGTCCTATTTGCGGCAGCTCGAGGCCAAGGCC
AAGGCCTTGGACGCAGCGGCGGTGGCGGCGCCGCCGTCGGCAGCTTCAGCATCGAAGCGAGGACCGACGGACGAA
GAGGACGAGTTTGCGGACGGTCAACCGCTACTGGAACCCTTTACCCAGTTGAACCTCGAGCGGCCATCGACGAGC
TTCCAGGGTCCCGCCTCGTCGGACAACTTCTTGCGCAACGTGCGCAAGCTCTACCACGACGACGATGGCGGCACC
AGCCTCGACTGCTGGCAGGCCAACCTGTACGAACCTGGGGCGCTGCCCGGACGGACGTTTGGGCTCCGTACGCGG
CTACCGCCGGTGGACACGGCGCGCCGGCTGTTCTCGGCGCAGCACGTCTATATCGGTACCATCTTCGCCTTTACG
GAGCCGCTCGAGGCGTTTGAGCAGATGCTGGGAGAGGCCTACGGTGGGCCGCCCGACCCGCGCGACCGTGAGGCC
TGCCTCAAATATGCCAAGGTGCTACTGGTGCTGGCCTTTGGGCAGCTCTACTCGGTCAACCAGTGGGTGGGCTTC
CGCGGCCCGCCGGGCTTCGACTACTTCGCCGACTCGCTCGGCCTGCTGCCGGAGACGCACGAGGAGGGCTCGCTT
GGCGGAGTCGAGGCGCTGGCGCTGGCAGGCTACTTCATGCAGAACATGAACCGGCGCGACGCCGCCTTCCAGTAC
CTCGGACGGGCCCTGCGCATGGCCGTGTCGCTCGGCCTCCACCTCGAGATGGGCGACGACGAAGACGAAGCCGGG
CGCGAGCGGCGGCGGCGCGTCTGGTGGTCCGTCTATAGCCTGGACCGCATATTGTGCGTCAAGTCGGGCAACCCG
CTGACGATCCAGGACGACGATATTGGGGTGGCGCTGCCGTCTCGGCTCCCGGGCGAACCGGAGCACGGGCCGGCG
TCGGTCCTGCGCGACTACACGCAGCTGTCGCGTATATTGGGCCAGATTCACGACGCCGTCTACCGTCGCTCAGTG
CCTCGCTCGGGCCGTAACCTAGTGGCCGCAGTGCAGACCATCGTCCGCGCCCTGTCGCGCTGGTTCCGCGAGCTG
CCGGCCGTGCTGCGGTTCGAGCCGCAGAGTTTCAGCCGCGAGAGCGTCGGCACCCTCGCCCACTACTACCAGTGC
ATCAACATGACGGTCCGTCCGTTGCTGCTGCACGTCGTCGAGCGTCGTCTGCGGGCCATCCGCTCCGGCGGACCG
GACGAGAAGGAGCGCGACTGGAAGGCCGGCCTGTCGCAGGCGACGGTGCGAGTCGTCGAGATGGGGCTGGGAGCC
GCCCACGATACGGTCAACATGATGGCCATTGCCGCCCAGCGGGACATGGTCGCCACCTACGGCTACATGGACGGC
GAGCACATCTTCTCGGCCTCCATCGTCCTCGTCATGGCCTGCGCCGCCTTCCCGGCCAACGCGGCCAACACGCTG
GCCATGCAGACGGGCCTAGGCCTCCTCCGCTACATGGGCGAGCGCGGCAACAGCCACATGGGCGCGCGCTACGAG
CTCCTGGCTTCGCTTCACGCGGGCGCGGGACAGGCCCTGTCGTCTACGTCGTCGTCGTCGCCGCCTCTCTCGCCT
CCGGTTCCGGTCTCGGCCTCGGCCTCGGCCTCGGCCTCGTTGTCGTCTTGTGCTCCCGCCGCCGTACCCGAGGCC
CTGGCATACTTCCCGGCCGTCGACAATAGCTTCCTGGACGAGCCTCTCTACGACGAGAGCGGGATGGATTTCGGC
CTTTGGGAGGAGGGCTTCGCCTGTCCGACTATGGATCTGGATTTCGATCTCGCTCAGAGGACTTCTTCGACGGCG
GGAGGCAATGTCAACCTATCTGATCTCATGTACAGCCACGGGTGA
Gene >Ophio5|1224
ATGACGTGCGTGTACGAGGGCGCGAGGAAGATTCTGGTCAACGAGTCGTGAGTGGCACTCAAAAGCCATAAAGAG
AGGCCCCTGCTGACCCGAGGGCGCGGCAGCTATTTGCGGCAGCTCGAGGCCAAGGCCAAGGCCTTGGACGGTGAG
TCTTGTCGTCATATCCGTCTCCCTGTTCTTCGCCTAACGCGAGCAGCAGCGGCGGTGGCGGCGCCGCCGTCGGCA
GCTTCAGCATCGAAGCGAGGACCGACGGACGAAGAGGACGAGTTTGCGGACGGTCAACCGCTACTGGAACCCTTT
ACCCAGTTGAACCTCGAGCGGCCATCGACGAGTAAGGAGACCGACCCCTTTCTCGGGGCATGTGACCGTCGAGGC
CTGCCGGGAATTGACCAGAACAACAGGCTTCCAGGGTCCCGCCTCGTCGGACAACTTCTTGCGCAACGTGCGCAA
GCTCTACCACGACGACGATGGCGGCACCAGCCTCGACTGCTGGCAGGCCAACCTGTACGAACCTGGGGCGCTGCC
CGGACGGACGTTTGGGCTCCGTACGCGGCTACCGCCGGTGGACACGGCGCGCCGGCTGTTCTCGGCGCAGCACGT
CTATATCGGTACCATCTTCGCCTTTACGGAGCCGCTCGAGGCGTTTGAGCAGATGCTGGGAGAGGCCTACGGTGG
GCCGCCCGACCCGCGCGACCGTGAGGCCTGCCTCAAATATGCCAAGGTGCTACTGGTGCTGGCCTTTGGGCAGCT
CTACTCGGTCAACCAGTGGGTGGGCTTCCGCGGCCCGCCGGGCTTCGACTACTTCGCCGACTCGCTCGGCCTGCT
GCCGGAGACGCACGAGGAGGGCTCGCTTGGCGGAGTCGAGGCGCTGGCGCTGGCAGGCTACTTCATGCAGAACAT
GAACCGGCGCGACGCCGCCTTCCAGTACCTCGGACGGGCCCTGCGCATGGCCGTGTCGCTCGGCCTCCACCTCGA
GATGGGCGACGACGAAGACGAAGCCGGGCGCGAGCGGCGGCGGCGCGTCTGGTGGTCCGTCTATAGCCTGGACCG
CATATTGTGCGTCAAGTCGGGCAACCCGCTGACGATCCAGGACGACGATATTGGGGTGGCGCTGCCGTCTCGGCT
CCCGGGCGAACCGGAGCACGGGCCGGCGTCGGTCCTGCGCGACTACACGCAGCTGTCGCGTATATTGGGCCAGAT
TCACGACGCCGTCTACCGTCGCTCAGTGCCTCGCTCGGGCCGTAACCTAGTGGCCGCAGTGCAGACCATCGTCCG
CGCCCTGTCGCGCTGGTTCCGCGAGCTGCCGGCCGTGCTGCGGTTCGAGCCGCAGAGTTTCAGCCGCGAGAGCGT
CGGCACCCTCGCCCACTACTACCAGTGCATCAACATGACGGTCCGTCCGTTGCTGCTGCACGTCGTCGAGCGTCG
TCTGCGGGCCATCCGCTCCGGCGGACCGGACGAGAAGGAGCGCGACTGGAAGGCCGGCCTGTCGCAGGCGACGGT
GCGAGTCGTCGAGATGGGGCTGGGAGCCGCCCACGATACGGTCAACATGATGGCCATTGCCGCCCAGCGGGACAT
GGTCGGTTGGTCTACCCAACCCCTTCTATCCTTTCCTCGTCGTACACGGCGCACACTGGCTCACTTCCAGCAGCC
ACCTACGGCTACATGGACGGCGAGCACATCTTCTCGGCCTCCATCGTCCTCGTCATGGCCTGCGCCGCCTTCCCG
GCCAACGCGGCCAACACGCTGGCCATGCAGACGGGCCTAGGCCTCCTCCGCTACATGGGCGAGCGCGGCAACAGC
CACATGGGCGCGCGCTACGAGCTCCTGGCTTCGCTTCACGCGGGCGCGGGACAGGCCCTGTCGTCTACGTCGTCG
TCGTCGCCGCCTCTCTCGCCTCCGGTTCCGGTCTCGGCCTCGGCCTCGGCCTCGGCCTCGTTGTCGTCTTGTGCT
CCCGCCGCCGTACCCGAGGCCCTGGCATACTTCCCGGCCGTCGACAATAGCTTCCTGGACGAGCCTCTCTACGAC
GAGAGCGGGATGGATTTCGGCCTTTGGGAGGAGGGCTTCGCCTGTCCGACTATGGATCTGGATTTCGATCTCGCT
CAGAGGACTTCTTCGACGGCGGGAGGCAATGTCAACCTATCTGATCTCATGTACAGCCACGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail