Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1220
Gene name
Locationscaffold_14:21525..22972
Strand-
Gene length (bp)1447
Transcript length (bp)1383
Coding sequence length (bp)1380
Protein length (aa) 460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14378 PAP2_3 PAP2 superfamily 5.1E-24 167 345
PF01569 PAP2 PAP2 superfamily 6.0E-09 236 347

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10142|AUR1_SCHPO Inositol phosphorylceramide synthase catalytic subunit aur1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aur1 PE=1 SV=1 56 368 5.0E-100
sp|O13332|AUR1_CANAL Inositol phosphorylceramide synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=AUR1 PE=1 SV=2 54 438 5.0E-99
sp|P36107|AUR1_YEAST Inositol phosphorylceramide synthase catalytic subunit AUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUR1 PE=1 SV=1 80 369 2.0E-84
sp|P38954|IPT1_YEAST Inositolphosphotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPT1 PE=1 SV=2 180 300 5.0E-16

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 80 102 22
2 122 144 22
3 151 173 22
4 183 205 22
5 212 231 19
6 264 286 22
7 298 320 22
8 330 352 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1220
MDSPGSPPRKPVLPTLWTENLTDAVLGRLPGRHQYGRPRSRSDVKQLRHGLPDITSLQHSFSLWDGVRDLRRRRW
HAADVQYLFLVALTLFSLAIAPPAPVLKATALMAVAWILLMPATRQFFLPSVTIWVWLVYFFCSRFIPYEYRPHI
WVRVLPALENVLYGANLSNILSAHQHAVLDILAWMPYGIIHFGAPATCSLLMFIFGAPGTTAVFARTFGWMSILG
VTIQLVFPCTPPWYENEHGLVPATYGMPGSPAGLARIDAIFGIDLYTTNFTAAPLPFGAFPSLHGGYAVLEALFM
SHCFPQFRIFFISYAGWIWWSTMYLSHHYAIDLVGGGLIGMAFFYTARARWLPRRQPDKLTRWDYDYVEIGTRAR
VADEEYAMGPVAVGEGGKYLGLGLVHHHRRASSSDGWTIGSSSSYSTSSGTVSPTSSDSSSGVFVDVDQHGAWDS
DAELPSALQR
Coding >Ophio5|1220
ATGGACAGTCCGGGCTCACCCCCAAGGAAGCCGGTCCTTCCGACGCTGTGGACCGAGAATTTGACCGACGCCGTC
CTCGGCCGTTTGCCTGGTCGGCACCAGTACGGCCGCCCGAGAAGCCGTTCCGACGTCAAGCAGCTGCGTCATGGT
CTCCCCGACATCACCTCTCTGCAGCACTCCTTTAGCCTATGGGATGGCGTGCGCGACTTGCGGAGGCGACGTTGG
CACGCTGCCGACGTCCAATACCTCTTTCTAGTTGCCTTGACGCTATTCTCTCTCGCCATCGCCCCGCCCGCTCCC
GTGCTCAAGGCCACGGCACTCATGGCCGTCGCCTGGATCCTCCTCATGCCCGCCACACGACAGTTCTTCCTGCCC
TCCGTCACCATCTGGGTCTGGCTCGTCTACTTCTTCTGTAGCCGCTTCATCCCCTACGAATACCGCCCTCACATC
TGGGTCCGCGTCCTGCCGGCCTTAGAGAACGTCCTCTACGGCGCGAACCTGTCCAACATCCTCTCCGCCCACCAG
CACGCCGTTCTCGACATCCTCGCTTGGATGCCATACGGCATCATCCACTTCGGCGCTCCGGCAACATGCTCGTTG
CTAATGTTTATTTTCGGCGCTCCCGGCACGACGGCCGTCTTCGCCCGCACCTTTGGCTGGATGAGCATCCTCGGC
GTCACCATTCAGCTCGTCTTCCCCTGCACTCCTCCTTGGTACGAAAACGAGCACGGCCTGGTTCCCGCGACGTAC
GGCATGCCCGGCTCTCCCGCCGGCCTGGCCCGTATAGACGCCATCTTCGGCATCGACCTCTACACTACAAACTTC
ACTGCCGCGCCCTTGCCCTTTGGTGCCTTTCCCTCCCTACACGGAGGCTACGCCGTGTTGGAGGCCCTTTTCATG
AGCCACTGCTTCCCGCAGTTCCGCATCTTCTTCATTAGCTACGCAGGTTGGATCTGGTGGTCCACCATGTATCTG
AGCCACCACTATGCCATCGACCTCGTCGGCGGCGGCCTCATCGGCATGGCCTTCTTCTACACCGCTCGCGCCCGT
TGGCTGCCACGCCGCCAACCGGACAAGTTGACGCGCTGGGATTACGATTACGTCGAGATAGGCACCCGCGCCCGC
GTCGCTGACGAGGAATACGCCATGGGCCCCGTCGCCGTCGGCGAAGGAGGGAAGTATCTGGGCCTCGGTCTGGTC
CATCATCACCGCCGCGCCAGCTCGAGCGACGGGTGGACCATCGGCAGCAGTTCCAGCTACAGCACAAGTAGCGGC
ACCGTCAGCCCCACCTCGTCTGACTCGTCGTCGGGCGTCTTCGTCGACGTGGACCAGCACGGCGCATGGGACAGC
GACGCCGAACTACCGAGCGCCCTCCAGCGG
Transcript >Ophio5|1220
ATGGACAGTCCGGGCTCACCCCCAAGGAAGCCGGTCCTTCCGACGCTGTGGACCGAGAATTTGACCGACGCCGTC
CTCGGCCGTTTGCCTGGTCGGCACCAGTACGGCCGCCCGAGAAGCCGTTCCGACGTCAAGCAGCTGCGTCATGGT
CTCCCCGACATCACCTCTCTGCAGCACTCCTTTAGCCTATGGGATGGCGTGCGCGACTTGCGGAGGCGACGTTGG
CACGCTGCCGACGTCCAATACCTCTTTCTAGTTGCCTTGACGCTATTCTCTCTCGCCATCGCCCCGCCCGCTCCC
GTGCTCAAGGCCACGGCACTCATGGCCGTCGCCTGGATCCTCCTCATGCCCGCCACACGACAGTTCTTCCTGCCC
TCCGTCACCATCTGGGTCTGGCTCGTCTACTTCTTCTGTAGCCGCTTCATCCCCTACGAATACCGCCCTCACATC
TGGGTCCGCGTCCTGCCGGCCTTAGAGAACGTCCTCTACGGCGCGAACCTGTCCAACATCCTCTCCGCCCACCAG
CACGCCGTTCTCGACATCCTCGCTTGGATGCCATACGGCATCATCCACTTCGGCGCTCCGGCAACATGCTCGTTG
CTAATGTTTATTTTCGGCGCTCCCGGCACGACGGCCGTCTTCGCCCGCACCTTTGGCTGGATGAGCATCCTCGGC
GTCACCATTCAGCTCGTCTTCCCCTGCACTCCTCCTTGGTACGAAAACGAGCACGGCCTGGTTCCCGCGACGTAC
GGCATGCCCGGCTCTCCCGCCGGCCTGGCCCGTATAGACGCCATCTTCGGCATCGACCTCTACACTACAAACTTC
ACTGCCGCGCCCTTGCCCTTTGGTGCCTTTCCCTCCCTACACGGAGGCTACGCCGTGTTGGAGGCCCTTTTCATG
AGCCACTGCTTCCCGCAGTTCCGCATCTTCTTCATTAGCTACGCAGGTTGGATCTGGTGGTCCACCATGTATCTG
AGCCACCACTATGCCATCGACCTCGTCGGCGGCGGCCTCATCGGCATGGCCTTCTTCTACACCGCTCGCGCCCGT
TGGCTGCCACGCCGCCAACCGGACAAGTTGACGCGCTGGGATTACGATTACGTCGAGATAGGCACCCGCGCCCGC
GTCGCTGACGAGGAATACGCCATGGGCCCCGTCGCCGTCGGCGAAGGAGGGAAGTATCTGGGCCTCGGTCTGGTC
CATCATCACCGCCGCGCCAGCTCGAGCGACGGGTGGACCATCGGCAGCAGTTCCAGCTACAGCACAAGTAGCGGC
ACCGTCAGCCCCACCTCGTCTGACTCGTCGTCGGGCGTCTTCGTCGACGTGGACCAGCACGGCGCATGGGACAGC
GACGCCGAACTACCGAGCGCCCTCCAGCGGTGA
Gene >Ophio5|1220
ATGGACAGTCCGGGCTCACCCCCAAGGAAGCCGGTCCTTCCGACGCTGTGGACCGAGAATTTGACCGACGCCGTC
CTCGGCCGTTTGCCTGGTCGGCACCAGTACGGCCGCCCGAGAAGCCGTTCCGACGTCAAGCAGCTGCGTCATGGT
CTCCCCGACATCACCTCTCTGCAGCACTCCTTTAGCCTATGGGATGGCGTGCGCGACTTGCGGAGGCGACGTTGG
CACGCTGCCGACGTCCAATACCTCTTTCTAGTTGCCTTGACGCTATTCTCTCTCGCCATCGCCCCGCCCGCTCCC
GTGCTCAAGGCCACGGCACTCATGGCCGTCGCCTGGATCCTCCTCATGCCCGCCACACGACAGTTCTTCCTGCCC
TCCGTCACCATCTGGGTCTGGCTCGTCTACTTCTTCTGTAGCCGGTGAGTCTCGAGTCGTTCCTCGGCATCTCCC
CAGATCGATTGGCATACTGACGACGAGGGCCAGCTTCATCCCCTACGAATACCGCCCTCACATCTGGGTCCGCGT
CCTGCCGGCCTTAGAGAACGTCCTCTACGGCGCGAACCTGTCCAACATCCTCTCCGCCCACCAGCACGCCGTTCT
CGACATCCTCGCTTGGATGCCATACGGCATCATCCACTTCGGCGCTCCGGCAACATGCTCGTTGCTAATGTTTAT
TTTCGGCGCTCCCGGCACGACGGCCGTCTTCGCCCGCACCTTTGGCTGGATGAGCATCCTCGGCGTCACCATTCA
GCTCGTCTTCCCCTGCACTCCTCCTTGGTACGAAAACGAGCACGGCCTGGTTCCCGCGACGTACGGCATGCCCGG
CTCTCCCGCCGGCCTGGCCCGTATAGACGCCATCTTCGGCATCGACCTCTACACTACAAACTTCACTGCCGCGCC
CTTGCCCTTTGGTGCCTTTCCCTCCCTACACGGAGGCTACGCCGTGTTGGAGGCCCTTTTCATGAGCCACTGCTT
CCCGCAGTTCCGCATCTTCTTCATTAGCTACGCAGGTTGGATCTGGTGGTCCACCATGTATCTGAGCCACCACTA
TGCCATCGACCTCGTCGGCGGCGGCCTCATCGGCATGGCCTTCTTCTACACCGCTCGCGCCCGTTGGCTGCCACG
CCGCCAACCGGACAAGTTGACGCGCTGGGATTACGATTACGTCGAGATAGGCACCCGCGCCCGCGTCGCTGACGA
GGAATACGCCATGGGCCCCGTCGCCGTCGGCGAAGGAGGGAAGTATCTGGGCCTCGGTCTGGTCCATCATCACCG
CCGCGCCAGCTCGAGCGACGGGTGGACCATCGGCAGCAGTTCCAGCTACAGCACAAGTAGCGGCACCGTCAGCCC
CACCTCGTCTGACTCGTCGTCGGGCGTCTTCGTCGACGTGGACCAGCACGGCGCATGGGACAGCGACGCCGAACT
ACCGAGCGCCCTCCAGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail