Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1213
Gene name
Locationscaffold_14:1492..2998
Strand+
Gene length (bp)1506
Transcript length (bp)1506
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09729 Gti1_Pac2 Gti1/Pac2 family 3.5E-10 1 29
PF09729 Gti1_Pac2 Gti1/Pac2 family 4.7E-05 67 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10294|PAC2_SCHPO cAMP-independent regulatory protein pac2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pac2 PE=2 SV=1 1 128 5.0E-28
sp|S0E3H0|WOR1_GIBF5 Global transcription regulator sge1 OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) GN=sge1 PE=2 SV=1 1 250 1.0E-11
sp|J9N5P9|WOR1_FUSO4 Global transcription regulator sge1 OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=sge1 PE=2 SV=1 1 120 3.0E-11
sp|P38867|YHX7_YEAST Uncharacterized protein YHR177W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR177W PE=1 SV=2 1 113 3.0E-09
sp|P40002|MIT1_YEAST Transcriptional regulator MIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIT1 PE=1 SV=1 1 124 7.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10294|PAC2_SCHPO cAMP-independent regulatory protein pac2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pac2 PE=2 SV=1 1 128 5.0E-28
sp|S0E3H0|WOR1_GIBF5 Global transcription regulator sge1 OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) GN=sge1 PE=2 SV=1 1 250 1.0E-11
sp|J9N5P9|WOR1_FUSO4 Global transcription regulator sge1 OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=sge1 PE=2 SV=1 1 120 3.0E-11
sp|P38867|YHX7_YEAST Uncharacterized protein YHR177W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR177W PE=1 SV=2 1 113 3.0E-09
sp|P40002|MIT1_YEAST Transcriptional regulator MIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIT1 PE=1 SV=1 1 124 7.0E-09
sp|W7MPI5|WOR1_GIBM7 Global transcription regulator sge1 OS=Gibberella moniliformis (strain M3125 / FGSC 7600) GN=sge1 PE=3 SV=1 1 250 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1213
MRRWTDGKSWSASRVSGSFLTYREMEGKRGGGFGGGGGGGNRRGGAGKTPDSGRGSDEDHDDGEPEGYRYKADGL
MKQSFSLTTTTGQHLHLISYYTRPHAGQPELPQPTNDPNLRHVVPPKGMYPESSMGESNQTPALTRAPMQQPYMM
AAQQHHPHHHAPYPTYAAQPGYGWPPSPAATPPYGHYTPAPYGHALPPQQQQQQQQQQQQQQQQQQQQQQQHHHA
LHHQPPTHHHQLQLGHSHPPHHHPPPPPPPPPSHQHHHHHPQQQHQGQHHHLPPQQQQQQQQQHYAHYTHAPPPP
PERNPLPPPLQNAKPSPYLGHGHHAPGHAHPHPHAHPHPHPHPHPHPHPHPHPHPHHARLHDSPRQKKLQAAAQA
VMCDPQLATSTTTNNNNNNNKSQGPLPALNAVTACMATPPTRHLSVTPPRSSAPHHLTSTTSSTTTRPSLSALLH
PTPANSEPGSAKTVSSGSAGSSPRTSGLVLDKAGASEDVRALRMLDRKFCI
Coding >Ophio5|1213
ATGCGACGCTGGACCGACGGGAAATCATGGAGCGCCAGCCGCGTGTCCGGCAGCTTCTTGACATATCGGGAGATG
GAGGGCAAGAGAGGAGGCGGCTTCGGAGGTGGCGGAGGCGGAGGGAATCGCCGAGGCGGCGCCGGGAAGACGCCG
GACTCGGGACGAGGTAGCGACGAGGATCACGACGATGGCGAGCCCGAGGGATACCGATACAAGGCCGACGGGCTG
ATGAAGCAGTCGTTCAGTCTGACGACGACGACGGGCCAGCACCTACACCTCATCTCGTATTACACGCGTCCGCAC
GCCGGCCAGCCCGAGCTTCCTCAGCCGACCAACGATCCGAACCTCCGGCATGTGGTACCTCCCAAGGGCATGTAT
CCCGAGTCGAGCATGGGCGAGTCGAATCAGACGCCTGCCCTGACACGGGCACCCATGCAGCAGCCGTACATGATG
GCGGCTCAGCAGCATCACCCTCATCACCATGCTCCCTACCCCACTTATGCCGCTCAGCCGGGCTATGGATGGCCT
CCTTCTCCGGCTGCCACGCCGCCGTACGGCCACTATACGCCGGCGCCGTATGGTCACGCGCTGCCTCCTCAGCAG
CAGCAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAGCAGCATCATCATGCA
CTTCATCATCAACCGCCAACGCATCATCACCAGCTTCAGCTTGGACACTCTCACCCTCCTCACCACCACCCTCCG
CCTCCGCCTCCTCCTCCACCGTCTCACCAGCACCACCACCACCACCCCCAGCAACAACACCAGGGACAACATCAT
CATCTCCCGCCACAGCAGCAGCAGCAGCAGCAACAACAACACTATGCTCACTACACGCACGCTCCCCCTCCACCT
CCTGAACGCAATCCGTTACCGCCGCCGCTACAGAATGCCAAGCCGTCGCCGTATCTAGGCCACGGCCACCATGCG
CCAGGCCATGCTCACCCTCACCCCCATGCTCACCCTCACCCTCATCCTCACCCTCACCCTCACCCTCACCCCCAT
CCTCACCCCCATCCTCACCATGCGCGATTGCACGACTCGCCGCGGCAGAAGAAGCTGCAGGCAGCAGCCCAGGCC
GTCATGTGCGATCCGCAACTGGCCACCTCCACCACAACCAACAACAACAACAACAACAACAAATCCCAAGGTCCG
CTTCCGGCTCTCAACGCCGTCACTGCCTGTATGGCGACGCCTCCGACTCGTCATCTGAGCGTCACGCCGCCCCGG
TCCTCGGCCCCTCATCACCTCACTTCCACCACGTCTTCTACCACCACCCGACCCAGCCTATCGGCGCTGCTTCAC
CCGACGCCCGCCAACAGCGAGCCGGGCAGCGCCAAGACGGTCAGCAGCGGTAGTGCTGGTAGCAGTCCCCGAACC
AGTGGTCTCGTCCTCGATAAGGCTGGCGCGAGCGAGGATGTGCGCGCCCTGAGGATGCTGGATCGCAAGTTTTGT
ATC
Transcript >Ophio5|1213
ATGCGACGCTGGACCGACGGGAAATCATGGAGCGCCAGCCGCGTGTCCGGCAGCTTCTTGACATATCGGGAGATG
GAGGGCAAGAGAGGAGGCGGCTTCGGAGGTGGCGGAGGCGGAGGGAATCGCCGAGGCGGCGCCGGGAAGACGCCG
GACTCGGGACGAGGTAGCGACGAGGATCACGACGATGGCGAGCCCGAGGGATACCGATACAAGGCCGACGGGCTG
ATGAAGCAGTCGTTCAGTCTGACGACGACGACGGGCCAGCACCTACACCTCATCTCGTATTACACGCGTCCGCAC
GCCGGCCAGCCCGAGCTTCCTCAGCCGACCAACGATCCGAACCTCCGGCATGTGGTACCTCCCAAGGGCATGTAT
CCCGAGTCGAGCATGGGCGAGTCGAATCAGACGCCTGCCCTGACACGGGCACCCATGCAGCAGCCGTACATGATG
GCGGCTCAGCAGCATCACCCTCATCACCATGCTCCCTACCCCACTTATGCCGCTCAGCCGGGCTATGGATGGCCT
CCTTCTCCGGCTGCCACGCCGCCGTACGGCCACTATACGCCGGCGCCGTATGGTCACGCGCTGCCTCCTCAGCAG
CAGCAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAGCAGCATCATCATGCA
CTTCATCATCAACCGCCAACGCATCATCACCAGCTTCAGCTTGGACACTCTCACCCTCCTCACCACCACCCTCCG
CCTCCGCCTCCTCCTCCACCGTCTCACCAGCACCACCACCACCACCCCCAGCAACAACACCAGGGACAACATCAT
CATCTCCCGCCACAGCAGCAGCAGCAGCAGCAACAACAACACTATGCTCACTACACGCACGCTCCCCCTCCACCT
CCTGAACGCAATCCGTTACCGCCGCCGCTACAGAATGCCAAGCCGTCGCCGTATCTAGGCCACGGCCACCATGCG
CCAGGCCATGCTCACCCTCACCCCCATGCTCACCCTCACCCTCATCCTCACCCTCACCCTCACCCTCACCCCCAT
CCTCACCCCCATCCTCACCATGCGCGATTGCACGACTCGCCGCGGCAGAAGAAGCTGCAGGCAGCAGCCCAGGCC
GTCATGTGCGATCCGCAACTGGCCACCTCCACCACAACCAACAACAACAACAACAACAACAAATCCCAAGGTCCG
CTTCCGGCTCTCAACGCCGTCACTGCCTGTATGGCGACGCCTCCGACTCGTCATCTGAGCGTCACGCCGCCCCGG
TCCTCGGCCCCTCATCACCTCACTTCCACCACGTCTTCTACCACCACCCGACCCAGCCTATCGGCGCTGCTTCAC
CCGACGCCCGCCAACAGCGAGCCGGGCAGCGCCAAGACGGTCAGCAGCGGTAGTGCTGGTAGCAGTCCCCGAACC
AGTGGTCTCGTCCTCGATAAGGCTGGCGCGAGCGAGGATGTGCGCGCCCTGAGGATGCTGGATCGCAAGTTTTGT
ATCTAA
Gene >Ophio5|1213
ATGCGACGCTGGACCGACGGGAAATCATGGAGCGCCAGCCGCGTGTCCGGCAGCTTCTTGACATATCGGGAGATG
GAGGGCAAGAGAGGAGGCGGCTTCGGAGGTGGCGGAGGCGGAGGGAATCGCCGAGGCGGCGCCGGGAAGACGCCG
GACTCGGGACGAGGTAGCGACGAGGATCACGACGATGGCGAGCCCGAGGGATACCGATACAAGGCCGACGGGCTG
ATGAAGCAGTCGTTCAGTCTGACGACGACGACGGGCCAGCACCTACACCTCATCTCGTATTACACGCGTCCGCAC
GCCGGCCAGCCCGAGCTTCCTCAGCCGACCAACGATCCGAACCTCCGGCATGTGGTACCTCCCAAGGGCATGTAT
CCCGAGTCGAGCATGGGCGAGTCGAATCAGACGCCTGCCCTGACACGGGCACCCATGCAGCAGCCGTACATGATG
GCGGCTCAGCAGCATCACCCTCATCACCATGCTCCCTACCCCACTTATGCCGCTCAGCCGGGCTATGGATGGCCT
CCTTCTCCGGCTGCCACGCCGCCGTACGGCCACTATACGCCGGCGCCGTATGGTCACGCGCTGCCTCCTCAGCAG
CAGCAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAGCAGCATCATCATGCA
CTTCATCATCAACCGCCAACGCATCATCACCAGCTTCAGCTTGGACACTCTCACCCTCCTCACCACCACCCTCCG
CCTCCGCCTCCTCCTCCACCGTCTCACCAGCACCACCACCACCACCCCCAGCAACAACACCAGGGACAACATCAT
CATCTCCCGCCACAGCAGCAGCAGCAGCAGCAACAACAACACTATGCTCACTACACGCACGCTCCCCCTCCACCT
CCTGAACGCAATCCGTTACCGCCGCCGCTACAGAATGCCAAGCCGTCGCCGTATCTAGGCCACGGCCACCATGCG
CCAGGCCATGCTCACCCTCACCCCCATGCTCACCCTCACCCTCATCCTCACCCTCACCCTCACCCTCACCCCCAT
CCTCACCCCCATCCTCACCATGCGCGATTGCACGACTCGCCGCGGCAGAAGAAGCTGCAGGCAGCAGCCCAGGCC
GTCATGTGCGATCCGCAACTGGCCACCTCCACCACAACCAACAACAACAACAACAACAACAAATCCCAAGGTCCG
CTTCCGGCTCTCAACGCCGTCACTGCCTGTATGGCGACGCCTCCGACTCGTCATCTGAGCGTCACGCCGCCCCGG
TCCTCGGCCCCTCATCACCTCACTTCCACCACGTCTTCTACCACCACCCGACCCAGCCTATCGGCGCTGCTTCAC
CCGACGCCCGCCAACAGCGAGCCGGGCAGCGCCAAGACGGTCAGCAGCGGTAGTGCTGGTAGCAGTCCCCGAACC
AGTGGTCTCGTCCTCGATAAGGCTGGCGCGAGCGAGGATGTGCGCGCCCTGAGGATGCTGGATCGCAAGTTTTGT
ATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail