Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1203
Gene name
Locationscaffold_139:23089..24165
Strand+
Gene length (bp)1076
Transcript length (bp)726
Coding sequence length (bp)723
Protein length (aa) 241

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2KIX3|TMM42_BOVIN Transmembrane protein 42 OS=Bos taurus GN=TMEM42 PE=2 SV=1 111 173 2.0E-06
sp|Q9CR22|TMM42_MOUSE Transmembrane protein 42 OS=Mus musculus GN=Tmem42 PE=2 SV=1 111 173 2.0E-06
sp|Q69YG0|TMM42_HUMAN Transmembrane protein 42 OS=Homo sapiens GN=TMEM42 PE=2 SV=2 111 173 3.0E-06
sp|Q5R7Q1|TMM42_PONAB Transmembrane protein 42 OS=Pongo abelii GN=TMEM42 PE=2 SV=1 111 173 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 97 119 22
3 140 162 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1203
MIRQRRVFANPNPSDESVMTTTTDPPPSPPPPPPLTTTTIKATRYAQWILLAVASGACAAFNGAFAKLTTTSLTS
GLAHAIARRLRLSDDANRFVELAVRGTFFALNLIFNGVMWTLFTAALARGSSATQVSIVNTSTNFVLTALLGFVI
FSEALPPLWWAGAALLVAGNVVVGSRDESADEHQDAPSHHGATGAPHAAAHADADERKPLLSGAARREAVLAGPV
DDDVPDLGQLPSDPTR
Coding >Ophio5|1203
ATGATCCGTCAAAGGCGCGTCTTCGCCAACCCGAACCCTTCAGACGAATCAGTCATGACGACGACGACGGATCCT
CCTCCTTCTCCTCCTCCTCCTCCTCCTCTGACGACGACGACGATAAAGGCGACACGCTACGCGCAGTGGATCTTA
CTCGCCGTCGCCAGTGGCGCCTGTGCGGCTTTCAACGGCGCCTTTGCGAAGCTAACGACGACGAGTCTTACCTCT
GGCCTCGCCCATGCCATCGCCCGCCGTCTGCGACTGTCCGACGACGCCAATAGATTCGTCGAGCTTGCCGTCCGT
GGCACCTTCTTCGCACTGAACCTCATCTTCAACGGCGTCATGTGGACGCTCTTCACTGCCGCCCTCGCCCGCGGC
TCCTCAGCTACCCAAGTCTCCATCGTCAACACGTCGACAAACTTCGTCCTGACCGCCCTGCTGGGCTTCGTCATC
TTTTCCGAAGCCCTACCTCCGCTGTGGTGGGCCGGCGCCGCGCTGCTCGTCGCCGGCAACGTCGTCGTCGGCTCC
AGGGATGAGAGCGCCGACGAGCATCAAGATGCTCCGAGTCACCATGGCGCTACCGGCGCTCCACACGCCGCAGCT
CACGCCGACGCCGATGAGAGAAAGCCGTTGCTGTCCGGCGCCGCTCGCCGGGAAGCCGTCCTCGCAGGCCCCGTC
GACGACGACGTTCCTGACCTGGGACAACTGCCGAGCGACCCTACTAGA
Transcript >Ophio5|1203
ATGATCCGTCAAAGGCGCGTCTTCGCCAACCCGAACCCTTCAGACGAATCAGTCATGACGACGACGACGGATCCT
CCTCCTTCTCCTCCTCCTCCTCCTCCTCTGACGACGACGACGATAAAGGCGACACGCTACGCGCAGTGGATCTTA
CTCGCCGTCGCCAGTGGCGCCTGTGCGGCTTTCAACGGCGCCTTTGCGAAGCTAACGACGACGAGTCTTACCTCT
GGCCTCGCCCATGCCATCGCCCGCCGTCTGCGACTGTCCGACGACGCCAATAGATTCGTCGAGCTTGCCGTCCGT
GGCACCTTCTTCGCACTGAACCTCATCTTCAACGGCGTCATGTGGACGCTCTTCACTGCCGCCCTCGCCCGCGGC
TCCTCAGCTACCCAAGTCTCCATCGTCAACACGTCGACAAACTTCGTCCTGACCGCCCTGCTGGGCTTCGTCATC
TTTTCCGAAGCCCTACCTCCGCTGTGGTGGGCCGGCGCCGCGCTGCTCGTCGCCGGCAACGTCGTCGTCGGCTCC
AGGGATGAGAGCGCCGACGAGCATCAAGATGCTCCGAGTCACCATGGCGCTACCGGCGCTCCACACGCCGCAGCT
CACGCCGACGCCGATGAGAGAAAGCCGTTGCTGTCCGGCGCCGCTCGCCGGGAAGCCGTCCTCGCAGGCCCCGTC
GACGACGACGTTCCTGACCTGGGACAACTGCCGAGCGACCCTACTAGATAG
Gene >Ophio5|1203
ATGATCCGTCAAAGGCGCGTCTTCGCCAACCCGAACCCTTCAGACGAATCAGTCATGACGACGACGACGGATCCT
CCTCCTTCTCCTCCTCCTCCTCCTCCTCTGACGACGACGACGATAAAGGCGACACGCTACGCGCAGTGGATCTTA
CTCGCCGTCGCCAGTGGCGCCTGTGCGGCTTTCAACGGCGCCTTTGCGAAGCTGTATGCGCCCGATCCCTTTTCT
TTTTCGTTTTTTTTCTTCCTTCCAAAGAGAGAGAGAAGAAAAACAACAACAAAGAGGCTTGGCTTGTTTATCGTG
CCTTTTTTTTTTTGCTGCTGGGTTGGCTGATACCTTGTGTGTGTGTGGTTGTTTTTTTTTGAGGGGGGGGAACGT
AGAACGACGACGAGTCTTACCTCTGGCCTCGCCCATGCCATCGCCCGCCGTCTGCGACTGTCCGACGACGCCAAT
AGATTCGTCGAGCTTGCCGTCCGTGGCGTCAGTTCCGCCTTGAACCTCTCCCTTCTTTGCTCTGACTGACAAACC
CCCCTTCCCCCCCCAACGCGAATTCTATCTACCCCCCTCCCCTTCCACCTTTTCCCCCCCAAAAAAGACCTTCTT
CGCACTGAACCTCATCTTCAACGGCGTCGTGAGCTTTCCCCCCCTTCCGGACATCCTCTGATTTACGTCTCTGTT
GACCGGTTCGCCAGATGTGGACGCTCTTCACTGCCGCCCTCGCCCGCGGCTCCTCAGCTACCCAAGTCTCCATCG
TCAACACGTCGACAAACTTCGTCCTGACCGCCCTGCTGGGCTTCGTCATCTTTTCCGAAGCCCTACCTCCGCTGT
GGTGGGCCGGCGCCGCGCTGCTCGTCGCCGGCAACGTCGTCGTCGGCTCCAGGGATGAGAGCGCCGACGAGCATC
AAGATGCTCCGAGTCACCATGGCGCTACCGGCGCTCCACACGCCGCAGCTCACGCCGACGCCGATGAGAGAAAGC
CGTTGCTGTCCGGCGCCGCTCGCCGGGAAGCCGTCCTCGCAGGCCCCGTCGACGACGACGTTCCTGACCTGGGAC
AACTGCCGAGCGACCCTACTAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail