Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1192
Gene name
Locationscaffold_139:24..714
Strand-
Gene length (bp)690
Transcript length (bp)483
Coding sequence length (bp)480
Protein length (aa) 160

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.3E-21 28 158
PF00083 Sugar_tr Sugar (and other) transporter 8.6E-10 37 137

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 20 160 2.0E-38
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 33 146 6.0E-22
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 20 150 3.0E-17
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 41 150 2.0E-15
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 64 144 9.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 20 160 2.0E-38
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 33 146 6.0E-22
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 20 150 3.0E-17
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 41 150 2.0E-15
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 64 144 9.0E-08
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 64 144 3.0E-07
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 64 144 6.0E-07
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 23 150 9.0E-07
sp|D8MQN9|MDTG_ERWBE Multidrug resistance protein MdtG OS=Erwinia billingiae (strain Eb661) GN=mdtG PE=3 SV=1 15 132 1.0E-06
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 21 158 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 65 87 22
3 100 122 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1192
MRGARAGKGPSQPPPPSAPFPTQQMFVLACCRICEPIAFMSIFPYIYYMIEDFHITRDASQISVYAGMVTSAFTL
AEFATGLMWGRLSDKIGRKPVLLTGLFGTALSVLVFGFAPSLPVALFARALGGLLNGNIGVLQTTVAELVTVREQ
QPRAYTIMPM
Coding >Ophio5|1192
ATGAGAGGAGCCCGTGCCGGCAAGGGGCCCAGCCAGCCGCCGCCACCATCTGCGCCCTTTCCGACGCAGCAGATG
TTTGTTCTAGCATGCTGCAGGATCTGCGAGCCCATTGCCTTCATGTCAATCTTCCCCTACATCTACTACATGATC
GAGGACTTTCACATCACCCGGGATGCCAGCCAAATCTCCGTCTACGCCGGAATGGTCACCTCGGCCTTTACCCTG
GCCGAGTTCGCGACCGGACTCATGTGGGGGCGTTTGAGTGACAAGATCGGCCGCAAGCCCGTTCTCTTGACCGGC
CTGTTCGGCACCGCCCTCAGTGTCCTCGTCTTTGGCTTCGCTCCGAGCTTGCCAGTCGCTCTGTTTGCCCGCGCC
CTCGGTGGCCTCCTGAACGGAAACATCGGCGTCCTGCAGACAACCGTTGCCGAGCTGGTGACGGTGAGGGAGCAG
CAGCCTCGGGCTTACACCATCATGCCCATG
Transcript >Ophio5|1192
ATGAGAGGAGCCCGTGCCGGCAAGGGGCCCAGCCAGCCGCCGCCACCATCTGCGCCCTTTCCGACGCAGCAGATG
TTTGTTCTAGCATGCTGCAGGATCTGCGAGCCCATTGCCTTCATGTCAATCTTCCCCTACATCTACTACATGATC
GAGGACTTTCACATCACCCGGGATGCCAGCCAAATCTCCGTCTACGCCGGAATGGTCACCTCGGCCTTTACCCTG
GCCGAGTTCGCGACCGGACTCATGTGGGGGCGTTTGAGTGACAAGATCGGCCGCAAGCCCGTTCTCTTGACCGGC
CTGTTCGGCACCGCCCTCAGTGTCCTCGTCTTTGGCTTCGCTCCGAGCTTGCCAGTCGCTCTGTTTGCCCGCGCC
CTCGGTGGCCTCCTGAACGGAAACATCGGCGTCCTGCAGACAACCGTTGCCGAGCTGGTGACGGTGAGGGAGCAG
CAGCCTCGGGCTTACACCATCATGCCCATGTGA
Gene >Ophio5|1192
ATGAGAGGAGCCCGTGCCGGCAAGGGGCCCAGCCAGCCGCCGCCACCATCTGCGCCCTTTCCGACGCAGCAGATG
TTTGTTCTAGGTAGGTAGGGTTGGGTGGGGCCGGATAATTCGCCTTGGCCGTAGTTTCGCTGACTCGATTCTTCA
GCATGCTGCAGGATCTGCGAGCCCATTGCCTTCATGTCAATCTTCCCCTACATCTACTACATGATCGAGGACTTT
CACATCACCCGGGATGCCAGCCAAATCTCCGTCTACGCCGGAATGGTCACCTCGGCCTTTACCCTGGCCGAGTTC
GCGACCGGACTCATGTGGGGGCGTTTGAGTGACAAGATCGGCCGCAAGCCCGTTCTCTTGACCGGCCTGTTCGGC
ACCGCCCTCAGTGTCCTCGTCTTTGGCTTCGCTCCGAGCTTGCCAGTCGCTCTGTTTGCCCGCGCCCTCGGTGGC
CTCCTGAACGGGTATGCCGCCGGCCCTACCATTTTATTGCCTGCTGCTGATTTCCGTCAAAGAAACATCGGCGTC
CTGCAGACAACCGTTGCCGAGCTGGTGACGGTGAGGGAGCAGCAGCGTAAGTGCCCAATTCGGCCGGCCAATGGG
CCTGCTGACGTTGCCCGCCGCAGCTCGGGCTTACACCATCATGCCCATGGTATGGTGCATTGGGTGCGTCCTTGT
CTCTCCAAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail