Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1191
Gene name
Locationscaffold_1387:125..1707
Strand-
Gene length (bp)1582
Transcript length (bp)999
Coding sequence length (bp)996
Protein length (aa) 332

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05368 NmrA NmrA-like family 1.7E-08 50 150
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.8E-08 51 154
PF13460 NAD_binding_10 NAD(P)H-binding 4.2E-07 54 155
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 2.2E-06 52 151

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25284|NDUA9_NEUCR NADH-ubiquinone oxidoreductase 40 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo40 PE=1 SV=2 4 329 6.0E-149
sp|Q5BK63|NDUA9_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Rattus norvegicus GN=Ndufa9 PE=1 SV=2 1 289 2.0E-35
sp|Q9DC69|NDUA9_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Mus musculus GN=Ndufa9 PE=1 SV=2 1 289 2.0E-33
sp|Q9SK66|NDUA9_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Arabidopsis thaliana GN=At2g20360 PE=1 SV=2 21 304 9.0E-31
sp|Q559Z0|NDUA9_DICDI NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Dictyostelium discoideum GN=ndufa9 PE=3 SV=1 12 310 3.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25284|NDUA9_NEUCR NADH-ubiquinone oxidoreductase 40 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo40 PE=1 SV=2 4 329 6.0E-149
sp|Q5BK63|NDUA9_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Rattus norvegicus GN=Ndufa9 PE=1 SV=2 1 289 2.0E-35
sp|Q9DC69|NDUA9_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Mus musculus GN=Ndufa9 PE=1 SV=2 1 289 2.0E-33
sp|Q9SK66|NDUA9_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Arabidopsis thaliana GN=At2g20360 PE=1 SV=2 21 304 9.0E-31
sp|Q559Z0|NDUA9_DICDI NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Dictyostelium discoideum GN=ndufa9 PE=3 SV=1 12 310 3.0E-29
sp|Q0MQB3|NDUA9_GORGO NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFA9 PE=2 SV=2 35 223 1.0E-27
sp|Q16795|NDUA9_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Homo sapiens GN=NDUFA9 PE=1 SV=2 39 223 2.0E-27
sp|P34943|NDUA9_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Bos taurus GN=NDUFA9 PE=1 SV=1 6 227 3.0E-27
sp|P0CB82|NDUA9_PONPY NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Pongo pygmaeus GN=NDUFA9 PE=2 SV=1 35 223 4.0E-27
sp|P0CB81|NDUA9_PONAB NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Pongo abelii GN=NDUFA9 PE=2 SV=1 35 223 4.0E-27
sp|Q0MQB4|NDUA9_PANTR NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Pan troglodytes GN=NDUFA9 PE=2 SV=1 39 223 5.0E-27
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1191
MIAPKIPSIARKAFCGALEKRLASDLSITRTGKPIARTEGGRSSLGGHTVAIFGATGQLGRYVVNRLARRGCTVV
IPFREEMAKRHLKVAGDLGKVIFIEFDLRNTASIEACVQHADTVYNFIGRNYPTKNFSLEDVHVEGTERITEAVK
NRVIRILRLEGPSRASCAAKLPGDDFTNNMKKLFWPVHSIDVGAALEKMLYDESTAGQTFELYGPKKYTMAQIKS
MVDREIFKQRRHINVPKALLKPFAGLLNRVLWWNTLSADEVEREFIDQVIDRKAKTFEDLGMKPGDISNFTYHYL
QGFRSSNFYDLPPATEKERKEEKKFIHVLNEL
Coding >Ophio5|1191
ATGATCGCACCGAAAATTCCTTCGATCGCTCGTAAGGCGTTTTGCGGCGCCCTCGAGAAGCGACTTGCCTCCGAC
CTCTCTATAACCAGGACTGGCAAGCCCATTGCCCGAACCGAGGGTGGCCGATCGTCTCTTGGAGGTCACACCGTG
GCCATATTCGGTGCGACGGGCCAGCTTGGGAGATATGTTGTTAATCGACTTGCTCGCCGGGGCTGTACTGTCGTC
ATTCCTTTTCGCGAGGAGATGGCCAAACGCCACCTCAAGGTAGCTGGAGATCTTGGCAAGGTTATTTTTATAGAG
TTTGACTTACGAAATACTGCCTCCATAGAAGCCTGCGTACAGCACGCGGACACTGTGTATAATTTTATTGGAAGG
AACTATCCCACGAAGAACTTTTCGCTGGAAGACGTTCATGTTGAGGGAACGGAGCGTATAACTGAGGCTGTGAAA
AATCGCGTCATCCGAATTTTACGCCTCGAAGGGCCGAGCCGAGCAAGTTGCGCGGCAAAACTTCCCGGAGACGAC
TTTACCAACAACATGAAGAAGCTCTTCTGGCCTGTTCACTCGATTGATGTGGGCGCAGCCTTGGAAAAAATGCTT
TACGACGAGTCTACCGCCGGCCAGACGTTTGAGCTTTACGGACCCAAGAAATATACCATGGCTCAGATTAAGTCT
ATGGTGGACAGAGAAATCTTCAAGCAGAGGCGCCATATCAACGTGCCTAAAGCATTGTTGAAGCCGTTCGCGGGG
CTTCTCAATCGTGTTCTGTGGTGGAACACACTGTCCGCTGATGAAGTAGAGCGAGAATTCATTGACCAAGTTATC
GACCGAAAGGCAAAGACATTTGAGGACCTCGGAATGAAACCGGGAGACATTTCGAACTTCACATACCACTACCTG
CAAGGATTCCGTAGCTCTAATTTCTATGACTTACCACCTGCCACAGAGAAGGAGAGAAAAGAGGAGAAAAAATTT
ATACATGTGCTAAACGAGCTT
Transcript >Ophio5|1191
ATGATCGCACCGAAAATTCCTTCGATCGCTCGTAAGGCGTTTTGCGGCGCCCTCGAGAAGCGACTTGCCTCCGAC
CTCTCTATAACCAGGACTGGCAAGCCCATTGCCCGAACCGAGGGTGGCCGATCGTCTCTTGGAGGTCACACCGTG
GCCATATTCGGTGCGACGGGCCAGCTTGGGAGATATGTTGTTAATCGACTTGCTCGCCGGGGCTGTACTGTCGTC
ATTCCTTTTCGCGAGGAGATGGCCAAACGCCACCTCAAGGTAGCTGGAGATCTTGGCAAGGTTATTTTTATAGAG
TTTGACTTACGAAATACTGCCTCCATAGAAGCCTGCGTACAGCACGCGGACACTGTGTATAATTTTATTGGAAGG
AACTATCCCACGAAGAACTTTTCGCTGGAAGACGTTCATGTTGAGGGAACGGAGCGTATAACTGAGGCTGTGAAA
AATCGCGTCATCCGAATTTTACGCCTCGAAGGGCCGAGCCGAGCAAGTTGCGCGGCAAAACTTCCCGGAGACGAC
TTTACCAACAACATGAAGAAGCTCTTCTGGCCTGTTCACTCGATTGATGTGGGCGCAGCCTTGGAAAAAATGCTT
TACGACGAGTCTACCGCCGGCCAGACGTTTGAGCTTTACGGACCCAAGAAATATACCATGGCTCAGATTAAGTCT
ATGGTGGACAGAGAAATCTTCAAGCAGAGGCGCCATATCAACGTGCCTAAAGCATTGTTGAAGCCGTTCGCGGGG
CTTCTCAATCGTGTTCTGTGGTGGAACACACTGTCCGCTGATGAAGTAGAGCGAGAATTCATTGACCAAGTTATC
GACCGAAAGGCAAAGACATTTGAGGACCTCGGAATGAAACCGGGAGACATTTCGAACTTCACATACCACTACCTG
CAAGGATTCCGTAGCTCTAATTTCTATGACTTACCACCTGCCACAGAGAAGGAGAGAAAAGAGGAGAAAAAATTT
ATACATGTGCTAAACGAGCTTTAA
Gene >Ophio5|1191
ATGATCGCACCGAAAATTCCTTCGATCGCTCGTAAGGCGTTTTGCGGCGCCCTCGAGAAGCGACTTGCCTCCGAC
CTCTCTATAACCAGGACTGGCAAGCCCATTGCCCGAACCGAGGGTGGCCGGTATGTCTTTACACTCTCCACGGCT
TGGAACTTCCCCATTGATAATTACGCCACCTAGATCGTCTCTTGGAGGTGATTCTTATCGTACCACTTACAGTCG
AACATCGCTGAATCACTAGGTAGGTCACACCGTGGCCATATTCGGTGCGACGGGCCAGCTTGGGAGATATGTTGT
TAATCGACTTGGTTTGTTACGTCGACGTCTCTTTTTTGGCCGTCAAACCTGCTAACTGGTTCCCGCAATCAGCTC
GCCGGGGCTGTACTGTCGTCATTCCTTTTCGCGAGGAGATGGCCAAACGCCACCTCAAGGTAGCTGGAGATCTTG
GCAAGGTTATTTTTATAGTAAGAATCTCACATCTATTTGCATCCGCAGCTACTAAAATCAAATTGTCACAGGAGT
TTGACTTACGAAATACTGCCTCCATAGAAGCCTGCGTACAGCACGCGGACACTGTGTATAATTTTATTGGAAGGA
ACTATCCCACGAAGTATGTTTATTTGTGGTCATGGTAAGTTCTCGCTAAATTGAAATAGGAACTTTTCGCTGGAA
GACGTTCATGTTGAGGGAACGGAGCGTATAACTGAGGCTGTGAAAAAGTTCGACGTCGACAGATACATTCATGTG
TCGTCATATAACGCCAACCCAGTCGCGTCATCCGAATTTTACGCCTCGAAGGTAGGTTATGTTTTCCTGGTAGGA
GATACGTTCGTCACTAATCCACAATGTCCGCTGATAAGGGCCGAGCCGAGCAAGTTGCGCGGCAAAACTTCCCGG
AGACGACTTTAGTCCGACCAGCCCCTATCTTCGGTTTCGAGGACAATTTACTGATTAAGCTGGCATCGTCGATCC
TGTTCACAGCCAACAACATGAAGAAGCTCTTCTGGCCTGTTCACGTGAGAACTCCACTCAGCTCCAAGTACGTGG
CTTTGAGTTTCTAATGTGTCATGCCGTGTCGGCAGTCGATTGATGTGGGCGCAGCCTTGGAAAAAATGCTTTACG
ACGAGTCTACCGCCGGCCAGACGTTTGAGCTTTACGGACCCAAGAAATATACCATGGCTCAGATTAAGTCTATGG
TGGACAGAGAAATCTTCAAGCAGAGGCGCCATATCAACGTGCCTAAAGCATTGTTGAAGCCGTTCGCGGGGCTTC
TCAATCGTGTTCTGTGGTGGAACACACTGTCCGCTGATGAAGTAGAGCGAGAATTCATTGACCAAGTTATCGACC
GAAAGGCAAAGACATTTGAGGACCTCGGAATGAAACCGGGAGACATTTCGAACTTCACATACCACTACCTGGTAG
GTGAAACAATCTCCACAACAGGGACTACAGCTGGTGCAGATACTTATATTTTACATAGCAAGGATTCCGTAGCTC
TAATTTCTATGACTTACCACCTGCCACAGAGAAGGAGAGAAAAGAGGAGAAAAAATTTATACATGTGCTAAACGA
GCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail