Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1181
Gene name
Locationscaffold_138:22525..24975
Strand+
Gene length (bp)2450
Transcript length (bp)2307
Coding sequence length (bp)2304
Protein length (aa) 768

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00330 Aconitase Aconitase family (aconitate hydratase) 3.0E-142 43 486
PF00694 Aconitase_C Aconitase C-terminal domain 9.3E-38 568 695

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WJ90|ACON2_ASPFU Putative aconitate hydratase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoB PE=2 SV=1 5 761 0.0E+00
sp|Q5B6D6|ACON2_EMENI Putative aconitate hydratase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acoB PE=3 SV=1 4 761 0.0E+00
sp|P39533|ACON2_YEAST Homocitrate dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACO2 PE=1 SV=1 2 763 0.0E+00
sp|Q9P7D4|ACON2_SCHPO Homocitrate dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP4H10.15 PE=3 SV=3 1 761 0.0E+00
sp|P49609|ACON_GRAGA Aconitate hydratase, mitochondrial OS=Gracilaria gracilis PE=3 SV=1 15 767 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WJ90|ACON2_ASPFU Putative aconitate hydratase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoB PE=2 SV=1 5 761 0.0E+00
sp|Q5B6D6|ACON2_EMENI Putative aconitate hydratase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acoB PE=3 SV=1 4 761 0.0E+00
sp|P39533|ACON2_YEAST Homocitrate dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACO2 PE=1 SV=1 2 763 0.0E+00
sp|Q9P7D4|ACON2_SCHPO Homocitrate dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP4H10.15 PE=3 SV=3 1 761 0.0E+00
sp|P49609|ACON_GRAGA Aconitate hydratase, mitochondrial OS=Gracilaria gracilis PE=3 SV=1 15 767 0.0E+00
sp|Q54XS2|ACON_DICDI Probable aconitate hydratase, mitochondrial OS=Dictyostelium discoideum GN=aco2 PE=3 SV=1 33 761 0.0E+00
sp|O13966|ACON_SCHPO Aconitate hydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.06c PE=3 SV=2 19 763 0.0E+00
sp|Q4WLN1|ACON_ASPFU Aconitate hydratase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoA PE=1 SV=1 19 768 0.0E+00
sp|C8VG90|ACON_EMENI Aconitate hydratase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acoA PE=2 SV=1 19 767 0.0E+00
sp|D4AT77|ACON_ARTBC Aconitate hydratase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07441 PE=1 SV=1 19 761 0.0E+00
sp|P19414|ACON_YEAST Aconitate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACO1 PE=1 SV=2 19 761 0.0E+00
sp|P34455|ACON_CAEEL Probable aconitate hydratase, mitochondrial OS=Caenorhabditis elegans GN=aco-2 PE=3 SV=2 19 761 0.0E+00
sp|P82611|ACON_CANAL Aconitate hydratase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACO1 PE=1 SV=2 19 761 0.0E+00
sp|Q99798|ACON_HUMAN Aconitate hydratase, mitochondrial OS=Homo sapiens GN=ACO2 PE=1 SV=2 19 761 0.0E+00
sp|Q99KI0|ACON_MOUSE Aconitate hydratase, mitochondrial OS=Mus musculus GN=Aco2 PE=1 SV=1 19 761 0.0E+00
sp|P20004|ACON_BOVIN Aconitate hydratase, mitochondrial OS=Bos taurus GN=ACO2 PE=1 SV=4 19 761 0.0E+00
sp|Q9ER34|ACON_RAT Aconitate hydratase, mitochondrial OS=Rattus norvegicus GN=Aco2 PE=1 SV=2 19 761 0.0E+00
sp|P16276|ACON_PIG Aconitate hydratase, mitochondrial OS=Sus scrofa GN=ACO2 PE=1 SV=1 19 761 0.0E+00
sp|Q9ZCF4|ACNA_RICPR Aconitate hydratase A OS=Rickettsia prowazekii (strain Madrid E) GN=acnA PE=3 SV=1 61 765 1.0E-58
sp|Q4UK20|ACNA_RICFE Aconitate hydratase A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=acnA PE=3 SV=1 14 765 5.0E-58
sp|Q1RKD5|ACNA_RICBR Aconitate hydratase A OS=Rickettsia bellii (strain RML369-C) GN=acnA PE=3 SV=1 61 765 8.0E-57
sp|Q68VV0|ACNA_RICTY Aconitate hydratase A OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=acnA PE=3 SV=1 61 765 6.0E-56
sp|Q2A1K3|ACNA_FRATH Aconitate hydratase A OS=Francisella tularensis subsp. holarctica (strain LVS) GN=acn PE=3 SV=1 68 692 7.0E-56
sp|Q92G90|ACNA_RICCN Aconitate hydratase A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=acnA PE=3 SV=1 14 765 2.0E-55
sp|Q94A28|ACO3M_ARATH Aconitate hydratase 3, mitochondrial OS=Arabidopsis thaliana GN=ACO3 PE=2 SV=3 69 765 3.0E-54
sp|P09339|ACNA_BACSU Aconitate hydratase A OS=Bacillus subtilis (strain 168) GN=citB PE=1 SV=4 69 712 5.0E-53
sp|O28084|LEUC2_ARCFU 3-isopropylmalate dehydratase large subunit 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuC2 PE=3 SV=1 40 473 2.0E-52
sp|Q59938|ACNA_STRMU Aconitate hydratase A OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=acn PE=3 SV=2 69 692 5.0E-52
sp|Q937N8|ACNA_CUPNE Aconitate hydratase A OS=Cupriavidus necator GN=acnM PE=1 SV=1 68 768 1.0E-51
sp|Q5SMF6|ACNA_THET8 Aconitate hydratase A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=acoA PE=3 SV=1 64 738 1.0E-51
sp|Q23500|ACOC_CAEEL Probable cytoplasmic aconitate hydratase OS=Caenorhabditis elegans GN=aco-1 PE=1 SV=1 69 712 2.0E-51
sp|P21399|ACOC_HUMAN Cytoplasmic aconitate hydratase OS=Homo sapiens GN=ACO1 PE=1 SV=3 69 765 2.0E-50
sp|Q9SIB9|ACO2M_ARATH Aconitate hydratase 2, mitochondrial OS=Arabidopsis thaliana GN=ACO2 PE=1 SV=2 69 765 6.0E-50
sp|Q8EJW3|ACND_SHEON 2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) OS=Shewanella oneidensis (strain MR-1) GN=acnD PE=1 SV=1 68 759 2.0E-49
sp|Q6YZX6|ACOC_ORYSJ Putative aconitate hydratase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os08g0191100 PE=3 SV=1 69 768 9.0E-49
sp|Q42669|ACOC_CUCMC Aconitate hydratase (Fragment) OS=Cucumis melo var. conomon GN=ACO PE=2 SV=1 124 765 1.0E-48
sp|P70920|ACNA_BRADU Aconitate hydratase A OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acnA PE=2 SV=2 69 767 1.0E-48
sp|Q42560|ACO1_ARATH Aconitate hydratase 1 OS=Arabidopsis thaliana GN=ACO1 PE=1 SV=2 69 765 5.0E-48
sp|Q8ZP52|ACNA_SALTY Aconitate hydratase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acnA PE=1 SV=1 69 765 1.0E-47
sp|Q54X73|ACOC_DICDI Probable cytoplasmic aconitate hydratase OS=Dictyostelium discoideum GN=aco1 PE=3 SV=1 69 692 1.0E-47
sp|Q2HZ33|LYS4_CANPA Homoaconitase, mitochondrial OS=Candida parapsilosis GN=LYS4 PE=3 SV=1 41 702 3.0E-47
sp|Q8CPC2|ACNA_STAES Aconitate hydratase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=acnA PE=3 SV=1 30 694 6.0E-47
sp|Q5HPJ0|ACNA_STAEQ Aconitate hydratase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=acnA PE=3 SV=1 30 694 7.0E-47
sp|P25516|ACNA_ECOLI Aconitate hydratase A OS=Escherichia coli (strain K12) GN=acnA PE=1 SV=3 69 765 8.0E-47
sp|Q01059|ACOC_RABIT Cytoplasmic aconitate hydratase OS=Oryctolagus cuniculus GN=ACO1 PE=1 SV=1 69 767 1.0E-46
sp|Q6BM98|LYS4_DEBHA Homoaconitase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LYS4 PE=3 SV=1 10 681 7.0E-46
sp|Q0VCU1|ACOC_BOVIN Cytoplasmic aconitate hydratase OS=Bos taurus GN=ACO1 PE=2 SV=1 69 765 8.0E-46
sp|P63434|ACNA_STAAW Aconitate hydratase A OS=Staphylococcus aureus (strain MW2) GN=acnA PE=3 SV=1 69 694 6.0E-45
sp|Q6G9K9|ACNA_STAAS Aconitate hydratase A OS=Staphylococcus aureus (strain MSSA476) GN=acnA PE=3 SV=1 69 694 6.0E-45
sp|P99148|ACNA_STAAN Aconitate hydratase A OS=Staphylococcus aureus (strain N315) GN=acnA PE=1 SV=1 69 694 6.0E-45
sp|P63433|ACNA_STAAM Aconitate hydratase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=acnA PE=3 SV=1 69 694 6.0E-45
sp|Q5HG69|ACNA_STAAC Aconitate hydratase A OS=Staphylococcus aureus (strain COL) GN=acnA PE=3 SV=1 69 694 6.0E-45
sp|P28271|ACOC_MOUSE Cytoplasmic aconitate hydratase OS=Mus musculus GN=Aco1 PE=1 SV=3 69 767 8.0E-45
sp|Q6GH55|ACNA_STAAR Aconitate hydratase A OS=Staphylococcus aureus (strain MRSA252) GN=acnA PE=3 SV=1 69 694 2.0E-44
sp|P37032|ACON_LEGPH Aconitate hydratase A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=acn PE=1 SV=1 60 767 3.0E-44
sp|Q6C791|LYS4_YARLI Homoaconitase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LYS4 PE=3 SV=1 41 490 6.0E-44
sp|B2KBD7|LEUC_ELUMP 3-isopropylmalate dehydratase large subunit OS=Elusimicrobium minutum (strain Pei191) GN=leuC PE=3 SV=1 123 486 6.0E-43
sp|Q63270|ACOC_RAT Cytoplasmic aconitate hydratase OS=Rattus norvegicus GN=Aco1 PE=1 SV=1 69 767 8.0E-43
sp|Q9WYC7|LEUC1_THEMA 3-isopropylmalate dehydratase large subunit 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuC1 PE=3 SV=1 40 489 1.0E-42
sp|Q4WUL6|LYS4_ASPFU Homoaconitase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lys4 PE=2 SV=1 40 489 1.0E-42
sp|Q9I3F5|ACNA_PSEAE Aconitate hydratase A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acnA PE=3 SV=1 61 765 4.0E-42
sp|Q6CT61|LYS4_KLULA Homoaconitase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LYS4 PE=3 SV=1 41 681 4.0E-42
sp|Q5A644|LYS4_CANAL Homoaconitase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LYS4 PE=3 SV=1 23 681 4.0E-42
sp|O08451|ACNA_MYCAV Aconitate hydratase A OS=Mycobacterium avium GN=acn PE=3 SV=1 65 765 3.0E-41
sp|Q58409|HACA_METJA Methanogen homoaconitase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hacA PE=1 SV=1 135 489 3.0E-40
sp|P49608|ACOC_CUCMA Aconitate hydratase, cytoplasmic OS=Cucurbita maxima PE=2 SV=1 69 491 4.0E-40
sp|P0CM02|LYS4_CRYNJ Homoaconitase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=LYS4 PE=3 SV=1 40 688 1.0E-39
sp|P0CM03|LYS4_CRYNB Homoaconitase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=LYS4 PE=3 SV=1 40 688 1.0E-39
sp|O67078|LEUC_AQUAE 3-isopropylmalate dehydratase large subunit OS=Aquifex aeolicus (strain VF5) GN=leuC PE=3 SV=1 136 486 5.0E-39
sp|Q1AVC5|LEUC2_RUBXD 3-isopropylmalate dehydratase large subunit 2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuC2 PE=3 SV=1 40 462 6.0E-39
sp|Q58FL6|LYS4_ASPNC Homoaconitase, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lysA PE=3 SV=1 5 486 1.0E-38
sp|A0JMA0|IREB2_XENTR Iron-responsive element-binding protein 2 OS=Xenopus tropicalis GN=ireb2 PE=2 SV=1 48 692 2.0E-38
sp|B4U7U5|LEUC_HYDS0 3-isopropylmalate dehydratase large subunit OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=leuC PE=3 SV=1 142 486 2.0E-38
sp|Q2RG98|LEUC_MOOTA 3-isopropylmalate dehydratase large subunit OS=Moorella thermoacetica (strain ATCC 39073) GN=leuC PE=3 SV=1 39 473 4.0E-38
sp|B2UYH6|LEUC_CLOBA 3-isopropylmalate dehydratase large subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=leuC PE=3 SV=1 39 489 5.0E-38
sp|Q75DX9|LYS4_ASHGO Homoaconitase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS4 PE=3 SV=2 21 462 1.0E-37
sp|B9MLV4|LEUC_CALBD 3-isopropylmalate dehydratase large subunit OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=leuC PE=3 SV=1 148 473 2.0E-37
sp|Q938C9|LEUC_MYCS2 3-isopropylmalate dehydratase large subunit OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=leuC PE=3 SV=1 135 489 2.0E-37
sp|Q8U2A1|LEUC1_PYRFU 3-isopropylmalate dehydratase large subunit 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=leuC1 PE=3 SV=1 125 486 3.0E-37
sp|Q9ZNE0|HACA_THET2 Homoaconitase large subunit OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hacA PE=1 SV=1 136 489 3.0E-37
sp|B0KAH5|LEUC_THEP3 3-isopropylmalate dehydratase large subunit OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=leuC PE=3 SV=1 39 473 4.0E-37
sp|B0K0Y2|LEUC_THEPX 3-isopropylmalate dehydratase large subunit OS=Thermoanaerobacter sp. (strain X514) GN=leuC PE=3 SV=1 39 473 4.0E-37
sp|Q2U9G3|LYS4_ASPOR Homoaconitase, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lys4 PE=3 SV=1 5 486 8.0E-37
sp|O27668|HACA_METTH Probable methanogen homoaconitase large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hacA PE=3 SV=1 135 489 1.0E-36
sp|Q6NTP2|IREB2_XENLA Iron-responsive element-binding protein 2 OS=Xenopus laevis GN=ireb2 PE=2 SV=1 124 740 1.0E-36
sp|Q0QLE2|DMDA_EUBBA 2,3-dimethylmalate dehydratase large subunit OS=Eubacterium barkeri GN=dmdA PE=1 SV=1 162 486 2.0E-36
sp|A4XJ48|LEUC_CALS8 3-isopropylmalate dehydratase large subunit OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=leuC PE=3 SV=1 148 473 2.0E-36
sp|Q30NZ0|LEUC_SULDN 3-isopropylmalate dehydratase large subunit OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=leuC PE=3 SV=1 40 489 2.0E-36
sp|Q97EE0|LEUC_CLOAB 3-isopropylmalate dehydratase large subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=leuC PE=3 SV=1 148 473 2.0E-36
sp|Q870W1|LYS4_NEUCR Homoaconitase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lys-4 PE=3 SV=1 6 486 3.0E-36
sp|Q8TVF2|LEUC1_METKA 3-isopropylmalate dehydratase large subunit 1 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=leuC1 PE=3 SV=1 142 489 3.0E-36
sp|Q9WZ24|LEUC2_THEMA 3-isopropylmalate dehydratase large subunit 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuC2 PE=3 SV=1 39 473 3.0E-36
sp|Q8RDK2|LEUC_CALS4 3-isopropylmalate dehydratase large subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=leuC PE=3 SV=1 39 473 4.0E-36
sp|Q4JC09|LEUC_SULAC 3-isopropylmalate dehydratase large subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=leuC PE=3 SV=1 141 489 4.0E-36
sp|Q24XT4|LEUC_DESHY 3-isopropylmalate dehydratase large subunit OS=Desulfitobacterium hafniense (strain Y51) GN=leuC PE=3 SV=2 129 486 6.0E-36
sp|B2TIQ9|LEUC_CLOBB 3-isopropylmalate dehydratase large subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=leuC PE=3 SV=1 39 489 8.0E-36
sp|P49367|LYS4_YEAST Homoaconitase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS4 PE=1 SV=1 24 681 9.0E-36
sp|Q4HVQ9|LYS4_GIBZE Homoaconitase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=LYS4 PE=3 SV=1 40 681 1.0E-35
sp|Q92412|LYS4_EMENI Homoaconitase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lys4 PE=3 SV=2 40 486 1.0E-35
sp|Q8PZT3|HACA_METMA Probable methanogen homoaconitase large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hacA PE=3 SV=1 141 462 1.0E-35
sp|Q9RTI6|LEUC2_DEIRA 3-isopropylmalate dehydratase large subunit 2 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuC2 PE=3 SV=1 39 486 2.0E-35
sp|Q4P521|LYS4_USTMA Homoaconitase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LYS4 PE=3 SV=2 39 473 2.0E-35
sp|A6LPX4|LEUC_CLOB8 3-isopropylmalate dehydratase large subunit OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=leuC PE=3 SV=1 141 489 2.0E-35
sp|Q8TQZ3|LEUC_METAC Probable 3-isopropylmalate dehydratase large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=leuC PE=3 SV=1 125 489 2.0E-35
sp|Q7M9Z9|LEUC_WOLSU 3-isopropylmalate dehydratase large subunit OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=leuC PE=3 SV=1 40 462 2.0E-35
sp|Q2GN26|LYS4_CHAGB Homoaconitase, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=LYS4 PE=3 SV=1 40 681 3.0E-35
sp|Q6L0K5|LEUC_PICTO 3-isopropylmalate dehydratase large subunit OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=leuC PE=3 SV=1 115 486 3.0E-35
sp|O28316|LEUC1_ARCFU 3-isopropylmalate dehydratase large subunit 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuC1 PE=3 SV=2 125 489 3.0E-35
sp|Q90875|ACOC_CHICK Cytoplasmic aconitate hydratase OS=Gallus gallus GN=ACO1 PE=2 SV=1 69 491 6.0E-35
sp|B8J4F9|LEUC_DESDA 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=leuC PE=3 SV=1 135 486 1.0E-34
sp|A9B805|LEUC_HERA2 3-isopropylmalate dehydratase large subunit OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=leuC PE=3 SV=1 146 489 2.0E-34
sp|A7IA28|LEUC_METB6 3-isopropylmalate dehydratase large subunit OS=Methanoregula boonei (strain 6A8) GN=leuC PE=3 SV=1 125 489 2.0E-34
sp|Q9UT74|LYS4_SCHPO Homoaconitase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys2 PE=3 SV=1 40 681 2.0E-34
sp|Q8TLF1|HACA_METAC Probable methanogen homoaconitase large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hacA PE=3 SV=1 141 462 4.0E-34
sp|Q6FM51|LYS4_CANGA Homoaconitase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS4 PE=3 SV=1 37 681 5.0E-34
sp|Q9UZ07|LEUC1_PYRAB 3-isopropylmalate dehydratase large subunit 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=leuC1 PE=3 SV=1 135 486 5.0E-34
sp|B2V844|LEUC_SULSY 3-isopropylmalate dehydratase large subunit OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=leuC PE=3 SV=1 39 473 6.0E-34
sp|B8CX22|LEUC_HALOH 3-isopropylmalate dehydratase large subunit OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=leuC PE=3 SV=1 124 473 7.0E-34
sp|Q8PUG1|LEUC_METMA Probable 3-isopropylmalate dehydratase large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=leuC PE=3 SV=2 130 489 8.0E-34
sp|B3VKQ2|IREB2_PIG Iron-responsive element-binding protein 2 OS=Sus scrofa GN=IREB2 PE=2 SV=1 124 503 1.0E-33
sp|Q2LWJ2|LEUC_SYNAS 3-isopropylmalate dehydratase large subunit OS=Syntrophus aciditrophicus (strain SB) GN=leuC PE=3 SV=1 148 486 1.0E-33
sp|B0TCR2|LEUC_HELMI 3-isopropylmalate dehydratase large subunit OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=leuC PE=3 SV=1 39 486 2.0E-33
sp|Q18AJ2|LEUC_PEPD6 3-isopropylmalate dehydratase large subunit OS=Peptoclostridium difficile (strain 630) GN=leuC PE=3 SV=1 124 462 2.0E-33
sp|Q726X4|LEUC_DESVH 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=leuC PE=3 SV=1 40 489 2.0E-33
sp|A5MZ75|LEUC_CLOK5 3-isopropylmalate dehydratase large subunit OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=leuC PE=3 SV=1 39 462 3.0E-33
sp|O85072|LEUC_BUCDN 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Diuraphis noxia GN=leuC PE=3 SV=1 40 483 3.0E-33
sp|A1VAE7|LEUC_DESVV 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=leuC PE=3 SV=1 40 489 3.0E-33
sp|Q01Z81|LEUC_SOLUE 3-isopropylmalate dehydratase large subunit OS=Solibacter usitatus (strain Ellin6076) GN=leuC PE=3 SV=1 40 489 4.0E-33
sp|Q7VH31|LEUC_HELHP 3-isopropylmalate dehydratase large subunit OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=leuC PE=3 SV=1 124 486 4.0E-33
sp|B5YKE0|LEUC_THEYD 3-isopropylmalate dehydratase large subunit OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=leuC PE=3 SV=1 39 486 4.0E-33
sp|A0RMG7|LEUC_CAMFF 3-isopropylmalate dehydratase large subunit OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=leuC PE=3 SV=1 40 462 4.0E-33
sp|A9A043|LEUC_DESOH 3-isopropylmalate dehydratase large subunit OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=leuC PE=3 SV=1 130 462 5.0E-33
sp|P48200|IREB2_HUMAN Iron-responsive element-binding protein 2 OS=Homo sapiens GN=IREB2 PE=1 SV=3 124 503 6.0E-33
sp|Q30WD3|LEUC_DESAG 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio alaskensis (strain G20) GN=leuC PE=3 SV=1 132 476 6.0E-33
sp|P56934|LEUC_BUCAI 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=leuC PE=3 SV=2 40 486 8.0E-33
sp|A7ZFP0|LEUC_CAMC1 3-isopropylmalate dehydratase large subunit OS=Campylobacter concisus (strain 13826) GN=leuC PE=3 SV=1 40 462 8.0E-33
sp|Q7ZAG7|LEUC_HALVD 3-isopropylmalate dehydratase large subunit OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=leuC PE=3 SV=2 96 489 1.0E-32
sp|Q8ZW41|LEUC_PYRAE 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=leuC PE=3 SV=1 40 473 2.0E-32
sp|Q74BX5|LEUC_GEOSL 3-isopropylmalate dehydratase large subunit OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=leuC PE=3 SV=1 40 486 2.0E-32
sp|Q97VY2|LEUC_SULSO 3-isopropylmalate dehydratase large subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuC PE=3 SV=1 124 489 2.0E-32
sp|Q39W70|LEUC_GEOMG 3-isopropylmalate dehydratase large subunit OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=leuC PE=3 SV=1 40 487 3.0E-32
sp|O27439|LEUC_METTH Probable 3-isopropylmalate dehydratase large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=leuC PE=3 SV=1 130 489 6.0E-32
sp|B9LUZ3|LEUC_HALLT 3-isopropylmalate dehydratase large subunit OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=leuC PE=3 SV=1 96 489 8.0E-32
sp|Q9RTN7|ACNA_DEIRA Aconitate hydratase A OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=acn PE=1 SV=1 69 497 8.0E-32
sp|B9L6Y8|LEUC_NAUPA 3-isopropylmalate dehydratase large subunit OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=leuC PE=3 SV=1 142 462 1.0E-31
sp|B8DM92|LEUC_DESVM 3-isopropylmalate dehydratase large subunit OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=leuC PE=3 SV=1 40 473 1.0E-31
sp|B1H0A6|LEUC_UNCTG 3-isopropylmalate dehydratase large subunit OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=leuC PE=3 SV=1 40 486 1.0E-31
sp|Q2JPG2|LEUC_SYNJB 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=leuC PE=3 SV=1 126 489 1.0E-31
sp|A4WMI6|LEUC_PYRAR 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=leuC PE=3 SV=1 48 473 2.0E-31
sp|Q62751|IREB2_RAT Iron-responsive element-binding protein 2 OS=Rattus norvegicus GN=Ireb2 PE=1 SV=2 124 499 2.0E-31
sp|A3DHI4|LEUC_CLOTH 3-isopropylmalate dehydratase large subunit OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=leuC PE=3 SV=1 39 473 3.0E-31
sp|B2HII1|LEUC_MYCMM 3-isopropylmalate dehydratase large subunit OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=leuC PE=3 SV=1 138 487 3.0E-31
sp|Q8EN69|LEUC_OCEIH 3-isopropylmalate dehydratase large subunit OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=leuC PE=3 SV=1 40 486 4.0E-31
sp|Q811J3|IREB2_MOUSE Iron-responsive element-binding protein 2 OS=Mus musculus GN=Ireb2 PE=1 SV=2 124 504 4.0E-31
sp|A6Q6J8|LEUC_SULNB 3-isopropylmalate dehydratase large subunit OS=Sulfurovum sp. (strain NBC37-1) GN=leuC PE=3 SV=1 40 462 6.0E-31
sp|O04916|ACOC_SOLTU Aconitate hydratase, cytoplasmic (Fragment) OS=Solanum tuberosum PE=2 SV=1 243 712 6.0E-31
sp|A6Q5L6|LEUC_NITSB 3-isopropylmalate dehydratase large subunit OS=Nitratiruptor sp. (strain SB155-2) GN=leuC PE=3 SV=1 40 462 8.0E-31
sp|A4YF03|LEUC_METS5 3-isopropylmalate dehydratase large subunit OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=leuC PE=3 SV=1 141 489 9.0E-31
sp|A9KT79|LEUC_CLOPH 3-isopropylmalate dehydratase large subunit OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=leuC PE=3 SV=1 148 474 2.0E-30
sp|A7HZP6|LEUC_CAMHC 3-isopropylmalate dehydratase large subunit OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=leuC PE=3 SV=1 40 462 2.0E-30
sp|A0AK94|LEUC_LISW6 3-isopropylmalate dehydratase large subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=leuC PE=3 SV=1 116 476 2.0E-30
sp|A5G0G6|LEUC_ACICJ 3-isopropylmalate dehydratase large subunit OS=Acidiphilium cryptum (strain JF-5) GN=leuC PE=3 SV=1 114 486 3.0E-30
sp|Q73VI7|LEUC_MYCPA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=leuC PE=3 SV=1 138 487 3.0E-30
sp|A0QJB7|LEUC_MYCA1 3-isopropylmalate dehydratase large subunit OS=Mycobacterium avium (strain 104) GN=leuC PE=3 SV=1 138 487 3.0E-30
sp|B7GH21|LEUC_ANOFW 3-isopropylmalate dehydratase large subunit OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=leuC PE=3 SV=1 40 476 3.0E-30
sp|B4UAN0|LEUC_ANASK 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter sp. (strain K) GN=leuC PE=3 SV=1 148 476 3.0E-30
sp|Q2IJC2|LEUC_ANADE 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=leuC PE=3 SV=1 148 476 4.0E-30
sp|O14289|LEUC_SCHPO 3-isopropylmalate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=leu2 PE=1 SV=1 40 690 4.0E-30
sp|Q2S0M6|LEUC_SALRD 3-isopropylmalate dehydratase large subunit OS=Salinibacter ruber (strain DSM 13855 / M31) GN=leuC PE=3 SV=1 120 489 5.0E-30
sp|A0PPZ6|LEUC_MYCUA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium ulcerans (strain Agy99) GN=leuC PE=3 SV=1 138 487 5.0E-30
sp|O31293|LEUC_BUCTS 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Thelaxes suberi GN=leuC PE=3 SV=1 40 486 6.0E-30
sp|P81291|LEUC_METJA Isopropylmalate/citramalate isomerase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=leuC PE=1 SV=1 142 486 7.0E-30
sp|B8J825|LEUC_ANAD2 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=leuC PE=3 SV=1 148 476 8.0E-30
sp|A5G7U4|LEUC_GEOUR 3-isopropylmalate dehydratase large subunit OS=Geobacter uraniireducens (strain Rf4) GN=leuC PE=3 SV=1 130 486 9.0E-30
sp|B0JY97|LEUC_MICAN 3-isopropylmalate dehydratase large subunit OS=Microcystis aeruginosa (strain NIES-843) GN=leuC PE=3 SV=1 104 489 9.0E-30
sp|Q94AR8|LEUC_ARATH 3-isopropylmalate dehydratase large subunit OS=Arabidopsis thaliana GN=IIL1 PE=1 SV=1 144 486 1.0E-29
sp|Q5ZLQ4|IREB2_CHICK Iron-responsive element-binding protein 2 OS=Gallus gallus GN=IREB2 PE=2 SV=1 115 499 1.0E-29
sp|A1T700|LEUC_MYCVP 3-isopropylmalate dehydratase large subunit OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=leuC PE=3 SV=1 138 487 1.0E-29
sp|Q6NH63|ACNA_CORDI Aconitate hydratase A OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=acn PE=3 SV=1 65 361 2.0E-29
sp|Q8Y5R7|LEUC_LISMO 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=leuC PE=3 SV=1 116 476 2.0E-29
sp|A4TE23|LEUC_MYCGI 3-isopropylmalate dehydratase large subunit OS=Mycobacterium gilvum (strain PYR-GCK) GN=leuC PE=3 SV=1 131 487 2.0E-29
sp|A7H0L8|LEUC_CAMC5 3-isopropylmalate dehydratase large subunit OS=Campylobacter curvus (strain 525.92) GN=leuC PE=3 SV=1 40 462 2.0E-29
sp|Q5V518|LEUC_HALMA 3-isopropylmalate dehydratase large subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=leuC PE=3 SV=1 127 489 2.0E-29
sp|Q2JQU3|LEUC_SYNJA 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain JA-3-3Ab) GN=leuC PE=3 SV=1 126 489 2.0E-29
sp|A8MDY8|LEUC_CALMQ 3-isopropylmalate dehydratase large subunit OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=leuC PE=3 SV=1 141 473 3.0E-29
sp|P55251|LEUC_RHIPU 3-isopropylmalate dehydratase OS=Rhizomucor pusillus GN=LEUA PE=3 SV=1 131 713 3.0E-29
sp|B8HLN1|LEUC_CYAP4 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=leuC PE=3 SV=1 126 489 3.0E-29
sp|B7K213|LEUC_CYAP8 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 8801) GN=leuC PE=3 SV=1 126 489 4.0E-29
sp|B7KH96|LEUC_CYAP7 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain PCC 7424) GN=leuC PE=3 SV=1 104 486 4.0E-29
sp|Q67MJ2|LEUC_SYMTH 3-isopropylmalate dehydratase large subunit OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=leuC PE=3 SV=1 122 463 4.0E-29
sp|A5UUP5|LEUC_ROSS1 3-isopropylmalate dehydratase large subunit OS=Roseiflexus sp. (strain RS-1) GN=leuC PE=3 SV=1 131 486 4.0E-29
sp|Q9EVH7|LEUC_BUCUH 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon helianthicola GN=leuC PE=3 SV=1 141 462 5.0E-29
sp|A8EQZ0|LEUC_ARCB4 3-isopropylmalate dehydratase large subunit OS=Arcobacter butzleri (strain RM4018) GN=leuC PE=3 SV=1 40 462 6.0E-29
sp|B1XLQ6|LEUC_SYNP2 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=leuC PE=3 SV=1 146 489 6.0E-29
sp|B6ELJ8|LEUC_ALISL 3-isopropylmalate dehydratase large subunit OS=Aliivibrio salmonicida (strain LFI1238) GN=leuC PE=3 SV=1 40 476 7.0E-29
sp|Q9EVI3|LEUC_BUCUS 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon solidaginis GN=leuC PE=3 SV=1 141 462 7.0E-29
sp|Q03UM2|LEUC_LEUMM 3-isopropylmalate dehydratase large subunit OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=leuC PE=3 SV=1 148 486 7.0E-29
sp|Q974R0|LEUC_SULTO 3-isopropylmalate dehydratase large subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuC PE=3 SV=1 129 466 8.0E-29
sp|Q9EVI0|LEUC_BUCUO 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon obscurum GN=leuC PE=3 SV=1 141 462 1.0E-28
sp|B8DBU2|LEUC_LISMH 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=leuC PE=3 SV=1 116 476 1.0E-28
sp|O33123|LEUC_MYCLE 3-isopropylmalate dehydratase large subunit OS=Mycobacterium leprae (strain TN) GN=leuC PE=3 SV=1 138 487 1.0E-28
sp|Q71Y33|LEUC_LISMF 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=leuC PE=3 SV=1 116 476 1.0E-28
sp|C1KWT3|LEUC_LISMC 3-isopropylmalate dehydratase large subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=leuC PE=3 SV=1 116 476 1.0E-28
sp|Q92A26|LEUC_LISIN 3-isopropylmalate dehydratase large subunit OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=leuC PE=3 SV=1 116 476 1.0E-28
sp|B8FMM4|LEUC_DESAA 3-isopropylmalate dehydratase large subunit OS=Desulfatibacillum alkenivorans (strain AK-01) GN=leuC PE=3 SV=1 39 473 1.0E-28
sp|A3PAX7|LEUC_PROM0 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9301) GN=leuC PE=3 SV=1 148 489 1.0E-28
sp|Q8NQ98|ACNA_CORGL Aconitate hydratase A OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=acn PE=1 SV=2 65 349 1.0E-28
sp|B7GNM7|LEUC_BIFLS 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=leuC PE=3 SV=1 40 489 2.0E-28
sp|Q5E858|LEUC_VIBF1 3-isopropylmalate dehydratase large subunit OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=leuC PE=3 SV=1 40 476 3.0E-28
sp|Q9EVG5|LEUC_BUCUA 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon aeneum GN=leuC PE=3 SV=1 141 462 3.0E-28
sp|Q7MP79|LEUC_VIBVY 3-isopropylmalate dehydratase large subunit OS=Vibrio vulnificus (strain YJ016) GN=leuC PE=3 SV=1 40 476 3.0E-28
sp|Q87SS9|LEUC_VIBPA 3-isopropylmalate dehydratase large subunit OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=leuC PE=3 SV=1 40 476 4.0E-28
sp|Q8DED9|LEUC_VIBVU 3-isopropylmalate dehydratase large subunit OS=Vibrio vulnificus (strain CMCP6) GN=leuC PE=3 SV=1 40 476 4.0E-28
sp|Q4JVM4|ACNA_CORJK Aconitate hydratase A OS=Corynebacterium jeikeium (strain K411) GN=acn PE=3 SV=1 65 347 4.0E-28
sp|Q6LV26|LEUC_PHOPR 3-isopropylmalate dehydratase large subunit OS=Photobacterium profundum GN=leuC PE=3 SV=2 40 476 4.0E-28
sp|Q9EVG8|LEUC_BUCUM 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon ambrosiae GN=leuC PE=3 SV=2 141 462 4.0E-28
sp|Q7VQJ8|LEUC_BLOFL 3-isopropylmalate dehydratase large subunit OS=Blochmannia floridanus GN=leuC PE=3 SV=1 140 462 5.0E-28
sp|Q8FTA8|ACNA_COREF Aconitate hydratase A OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=acn PE=3 SV=2 65 352 5.0E-28
sp|B5FGH2|LEUC_VIBFM 3-isopropylmalate dehydratase large subunit OS=Vibrio fischeri (strain MJ11) GN=leuC PE=3 SV=1 40 476 5.0E-28
sp|P75764|YBHJ_ECOLI Uncharacterized protein YbhJ OS=Escherichia coli (strain K12) GN=ybhJ PE=3 SV=2 118 435 6.0E-28
sp|B1MDQ1|LEUC_MYCA9 3-isopropylmalate dehydratase large subunit OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=leuC PE=3 SV=1 131 486 6.0E-28
sp|A0LVA3|LEUC_ACIC1 3-isopropylmalate dehydratase large subunit OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=leuC PE=3 SV=1 138 486 6.0E-28
sp|A6L1V8|LEUC_BACV8 3-isopropylmalate dehydratase large subunit OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=leuC PE=3 SV=1 40 476 8.0E-28
sp|A1RVH3|LEUC_PYRIL 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=leuC PE=3 SV=1 40 473 9.0E-28
sp|Q8TW29|LEUC2_METKA 3-isopropylmalate dehydratase large subunit 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=leuC2 PE=3 SV=1 59 492 1.0E-27
sp|Q66EM3|LEUC_YERPS 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=leuC PE=3 SV=1 40 463 1.0E-27
sp|B2K4C7|LEUC_YERPB 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=leuC PE=3 SV=1 40 463 1.0E-27
sp|B1JKA0|LEUC_YERPY 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=leuC PE=3 SV=1 40 463 1.0E-27
sp|A4TQA4|LEUC_YERPP 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis (strain Pestoides F) GN=leuC PE=3 SV=1 40 463 1.0E-27
sp|Q1CMP7|LEUC_YERPN 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=leuC PE=3 SV=1 40 463 1.0E-27
sp|A9R144|LEUC_YERPG 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=leuC PE=3 SV=1 40 463 1.0E-27
sp|Q8ZIH0|LEUC_YERPE 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis GN=leuC PE=3 SV=1 40 463 1.0E-27
sp|Q1C1Z4|LEUC_YERPA 3-isopropylmalate dehydratase large subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=leuC PE=3 SV=1 40 463 1.0E-27
sp|A7FM86|LEUC_YERP3 3-isopropylmalate dehydratase large subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=leuC PE=3 SV=1 40 463 1.0E-27
sp|Q9EVI6|LEUC_BUCUN 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon sonchi GN=leuC PE=3 SV=1 40 462 1.0E-27
sp|P44968|LEUC_HAEIN 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=leuC PE=3 SV=2 140 486 1.0E-27
sp|B1XV55|LEUC_POLNS 3-isopropylmalate dehydratase large subunit OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=leuC PE=3 SV=1 148 476 1.0E-27
sp|Q2J6W9|LEUC_FRASC 3-isopropylmalate dehydratase large subunit OS=Frankia sp. (strain CcI3) GN=leuC PE=3 SV=1 138 476 2.0E-27
sp|Q1BAQ4|LEUC_MYCSS 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain MCS) GN=leuC PE=3 SV=1 138 487 2.0E-27
sp|A1UEA8|LEUC_MYCSK 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain KMS) GN=leuC PE=3 SV=1 138 487 2.0E-27
sp|B1YD98|LEUC_PYRNV 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=leuC PE=3 SV=1 125 473 2.0E-27
sp|A3PXR2|LEUC_MYCSJ 3-isopropylmalate dehydratase large subunit OS=Mycobacterium sp. (strain JLS) GN=leuC PE=3 SV=1 138 487 2.0E-27
sp|A8G2R6|LEUC_PROM2 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9215) GN=leuC PE=3 SV=1 148 489 2.0E-27
sp|A3MWJ4|LEUC_PYRCJ 3-isopropylmalate dehydratase large subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=leuC PE=3 SV=1 125 473 2.0E-27
sp|B8HAC9|LEUC_ARTCA 3-isopropylmalate dehydratase large subunit OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=leuC PE=3 SV=1 148 487 2.0E-27
sp|B5EHU2|LEUC_GEOBB 3-isopropylmalate dehydratase large subunit OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=leuC PE=3 SV=1 130 486 2.0E-27
sp|C5D5L8|LEUC_GEOSW 3-isopropylmalate dehydratase large subunit OS=Geobacillus sp. (strain WCH70) GN=leuC PE=3 SV=1 40 476 2.0E-27
sp|P9WQF5|LEUC_MYCTU 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=leuC PE=1 SV=1 161 487 2.0E-27
sp|P9WQF4|LEUC_MYCTO 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=leuC PE=3 SV=1 161 487 2.0E-27
sp|A5U6Z9|LEUC_MYCTA 3-isopropylmalate dehydratase large subunit OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=leuC PE=3 SV=1 161 487 2.0E-27
sp|Q9EVH4|LEUC_BUCUE 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon erigeronensis GN=leuC PE=3 SV=1 40 462 2.0E-27
sp|C1AGA3|LEUC_MYCBT 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=leuC PE=3 SV=1 161 487 2.0E-27
sp|A1KMY2|LEUC_MYCBP 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=leuC PE=3 SV=1 161 487 2.0E-27
sp|Q7TXH6|LEUC_MYCBO 3-isopropylmalate dehydratase large subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=leuC PE=1 SV=1 161 487 2.0E-27
sp|A0RBL4|LEUC_BACAH 3-isopropylmalate dehydratase large subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=leuC PE=3 SV=1 148 476 3.0E-27
sp|B1WZV3|LEUC_CYAA5 3-isopropylmalate dehydratase large subunit OS=Cyanothece sp. (strain ATCC 51142) GN=leuC PE=3 SV=1 126 489 3.0E-27
sp|A1R7K0|LEUC_ARTAT 3-isopropylmalate dehydratase large subunit OS=Arthrobacter aurescens (strain TC1) GN=leuC PE=3 SV=1 131 487 3.0E-27
sp|Q1IMI3|LEUC_KORVE 3-isopropylmalate dehydratase large subunit OS=Koribacter versatilis (strain Ellin345) GN=leuC PE=3 SV=1 40 463 3.0E-27
sp|Q5KWJ5|LEUC_GEOKA 3-isopropylmalate dehydratase large subunit OS=Geobacillus kaustophilus (strain HTA426) GN=leuC PE=3 SV=1 128 486 3.0E-27
sp|B1LXK9|LEUC_METRJ 3-isopropylmalate dehydratase large subunit OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=leuC PE=3 SV=1 40 476 4.0E-27
sp|Q65VS0|LEUC1_MANSM 3-isopropylmalate dehydratase large subunit 1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuC1 PE=3 SV=1 140 476 4.0E-27
sp|Q9AQC6|LEUC_BUCUL 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Uroleucon rurale GN=leuC PE=3 SV=1 141 462 4.0E-27
sp|A4IRH6|LEUC_GEOTN 3-isopropylmalate dehydratase large subunit OS=Geobacillus thermodenitrificans (strain NG80-2) GN=leuC PE=3 SV=2 40 476 4.0E-27
sp|B0CG35|LEUC_ACAM1 3-isopropylmalate dehydratase large subunit OS=Acaryochloris marina (strain MBIC 11017) GN=leuC PE=3 SV=1 126 486 5.0E-27
sp|P54384|LEUC_SYNY3 3-isopropylmalate dehydratase large subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=leuC PE=3 SV=2 126 486 5.0E-27
sp|B1MVR0|LEUC_LEUCK 3-isopropylmalate dehydratase large subunit OS=Leuconostoc citreum (strain KM20) GN=leuC PE=3 SV=1 135 486 5.0E-27
sp|Q0RDK7|LEUC_FRAAA 3-isopropylmalate dehydratase large subunit OS=Frankia alni (strain ACN14a) GN=leuC PE=3 SV=1 138 476 5.0E-27
sp|Q5YRY0|LEUC_NOCFA 3-isopropylmalate dehydratase large subunit OS=Nocardia farcinica (strain IFM 10152) GN=leuC PE=3 SV=1 138 487 5.0E-27
sp|Q3IRQ4|LEUC_NATPD 3-isopropylmalate dehydratase large subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=leuC PE=3 SV=1 148 489 6.0E-27
sp|Q8E9N4|LEUC_SHEON 3-isopropylmalate dehydratase large subunit OS=Shewanella oneidensis (strain MR-1) GN=leuC PE=3 SV=1 40 463 6.0E-27
sp|Q49Z14|LEUC_STAS1 3-isopropylmalate dehydratase large subunit OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=leuC PE=3 SV=1 131 476 7.0E-27
sp|A1TLH6|LEUC_ACIAC 3-isopropylmalate dehydratase large subunit OS=Acidovorax citrulli (strain AAC00-1) GN=leuC PE=3 SV=1 40 476 8.0E-27
sp|A0JXX8|LEUC_ARTS2 3-isopropylmalate dehydratase large subunit OS=Arthrobacter sp. (strain FB24) GN=leuC PE=3 SV=1 131 487 8.0E-27
sp|B7KRK4|LEUC_METC4 3-isopropylmalate dehydratase large subunit OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=leuC PE=3 SV=1 40 476 8.0E-27
sp|A7NJH2|LEUC_ROSCS 3-isopropylmalate dehydratase large subunit OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=leuC PE=3 SV=1 131 488 9.0E-27
sp|Q8ZRJ0|LEUC2_SALTY 3-isopropylmalate dehydratase large subunit 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=leuC2 PE=3 SV=1 40 476 9.0E-27
sp|A8L567|LEUC_FRASN 3-isopropylmalate dehydratase large subunit OS=Frankia sp. (strain EAN1pec) GN=leuC PE=3 SV=1 138 476 9.0E-27
sp|A7HBI2|LEUC_ANADF 3-isopropylmalate dehydratase large subunit OS=Anaeromyxobacter sp. (strain Fw109-5) GN=leuC PE=3 SV=1 40 463 1.0E-26
sp|A1JJH5|LEUC_YERE8 3-isopropylmalate dehydratase large subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=leuC PE=3 SV=1 40 463 1.0E-26
sp|A2BUN7|LEUC_PROM5 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9515) GN=leuC PE=3 SV=1 131 489 1.0E-26
sp|Q8FPR3|LEUC_COREF 3-isopropylmalate dehydratase large subunit OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=leuC PE=3 SV=1 131 486 1.0E-26
sp|A0L1Q8|LEUC_SHESA 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain ANA-3) GN=leuC PE=3 SV=1 44 463 1.0E-26
sp|A5UD83|LEUC_HAEIE 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain PittEE) GN=leuC PE=3 SV=1 140 476 1.0E-26
sp|Q4QLS2|LEUC_HAEI8 3-isopropylmalate dehydratase large subunit OS=Haemophilus influenzae (strain 86-028NP) GN=leuC PE=3 SV=1 140 476 1.0E-26
sp|Q3M614|LEUC_ANAVT 3-isopropylmalate dehydratase large subunit OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=leuC PE=3 SV=1 126 486 2.0E-26
sp|Q5MZY3|LEUC_SYNP6 3-isopropylmalate dehydratase large subunit OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=leuC PE=3 SV=1 126 489 2.0E-26
sp|Q31LZ1|LEUC_SYNE7 3-isopropylmalate dehydratase large subunit OS=Synechococcus elongatus (strain PCC 7942) GN=leuC PE=3 SV=1 126 489 2.0E-26
sp|P59519|LEUC_BUCBP 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=leuC PE=3 SV=1 40 486 2.0E-26
sp|C6DEW0|LEUC_PECCP 3-isopropylmalate dehydratase large subunit OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=leuC PE=3 SV=1 40 463 2.0E-26
sp|Q6D0G6|LEUC_PECAS 3-isopropylmalate dehydratase large subunit OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=leuC PE=3 SV=1 40 463 2.0E-26
sp|B8GQD6|LEUC_THISH 3-isopropylmalate dehydratase large subunit OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=leuC PE=3 SV=1 131 463 2.0E-26
sp|A7MWC3|LEUC_VIBCB 3-isopropylmalate dehydratase large subunit OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=leuC PE=3 SV=1 40 476 2.0E-26
sp|Q89X98|LEUC1_BRADU 3-isopropylmalate dehydratase large subunit 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuC1 PE=3 SV=2 37 463 2.0E-26
sp|Q8YX02|LEUC_NOSS1 3-isopropylmalate dehydratase large subunit OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=leuC PE=3 SV=1 126 486 2.0E-26
sp|A5FKC6|LEUC_FLAJ1 3-isopropylmalate dehydratase large subunit OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=leuC PE=3 SV=1 131 489 2.0E-26
sp|Q8DKF0|LEUC_THEEB 3-isopropylmalate dehydratase large subunit OS=Thermosynechococcus elongatus (strain BP-1) GN=leuC PE=3 SV=1 126 489 2.0E-26
sp|A7H665|LEUC_CAMJD 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=leuC PE=3 SV=1 40 491 3.0E-26
sp|Q326G3|LEUC_SHIBS 3-isopropylmalate dehydratase large subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=leuC PE=3 SV=1 40 463 3.0E-26
sp|B8F3W8|LEUC_HAEPS 3-isopropylmalate dehydratase large subunit OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=leuC PE=3 SV=1 38 463 3.0E-26
sp|A1REY2|LEUC_SHESW 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain W3-18-1) GN=leuC PE=3 SV=1 44 463 3.0E-26
sp|A1AW36|LEUC_RUTMC 3-isopropylmalate dehydratase large subunit OS=Ruthia magnifica subsp. Calyptogena magnifica GN=leuC PE=3 SV=2 40 462 3.0E-26
sp|Q0HE67|LEUC_SHESM 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain MR-4) GN=leuC PE=3 SV=1 44 463 3.0E-26
sp|Q8CNL1|LEUC_STAES 3-isopropylmalate dehydratase large subunit OS=Staphylococcus epidermidis (strain ATCC 12228) GN=leuC PE=3 SV=1 131 486 3.0E-26
sp|Q2G958|LEUC_NOVAD 3-isopropylmalate dehydratase large subunit OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=leuC PE=3 SV=1 131 489 4.0E-26
sp|B2GCB8|LEUC_LACF3 3-isopropylmalate dehydratase large subunit OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=leuC PE=3 SV=1 131 486 4.0E-26
sp|Q47WG2|LEUC_COLP3 3-isopropylmalate dehydratase large subunit OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=leuC PE=3 SV=1 118 486 4.0E-26
sp|B5ENJ1|LEUC_ACIF5 3-isopropylmalate dehydratase large subunit OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=leuC PE=3 SV=1 40 476 4.0E-26
sp|B7J5E0|LEUC_ACIF2 3-isopropylmalate dehydratase large subunit OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=leuC PE=3 SV=1 40 476 4.0E-26
sp|Q3IJS4|LEUC_PSEHT 3-isopropylmalate dehydratase large subunit OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=leuC PE=3 SV=1 117 463 4.0E-26
sp|Q7NFV7|LEUC_GLOVI 3-isopropylmalate dehydratase large subunit OS=Gloeobacter violaceus (strain PCC 7421) GN=leuC PE=3 SV=1 131 476 4.0E-26
sp|Q73B98|LEUC_BACC1 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=leuC PE=3 SV=1 148 476 5.0E-26
sp|Q7N127|LEUC_PHOLL 3-isopropylmalate dehydratase large subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=leuC PE=3 SV=1 137 463 5.0E-26
sp|Q4JUX2|LEUC_CORJK 3-isopropylmalate dehydratase large subunit OS=Corynebacterium jeikeium (strain K411) GN=leuC PE=3 SV=1 39 486 5.0E-26
sp|A4SWW8|LEUC_POLSQ 3-isopropylmalate dehydratase large subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=leuC PE=3 SV=1 148 476 5.0E-26
sp|Q07WH1|LEUC_SHEFN 3-isopropylmalate dehydratase large subunit OS=Shewanella frigidimarina (strain NCIMB 400) GN=leuC PE=3 SV=1 41 463 5.0E-26
sp|A1W1X0|LEUC_CAMJJ 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=leuC PE=3 SV=1 40 491 5.0E-26
sp|C3LR34|LEUC_VIBCM 3-isopropylmalate dehydratase large subunit OS=Vibrio cholerae serotype O1 (strain M66-2) GN=leuC PE=3 SV=1 40 476 6.0E-26
sp|Q9KP81|LEUC_VIBCH 3-isopropylmalate dehydratase large subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=leuC PE=3 SV=1 40 476 6.0E-26
sp|A5F5E2|LEUC_VIBC3 3-isopropylmalate dehydratase large subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=leuC PE=3 SV=1 40 476 6.0E-26
sp|Q4L7U2|LEUC_STAHJ 3-isopropylmalate dehydratase large subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=leuC PE=3 SV=1 131 476 6.0E-26
sp|Q9V1J0|LEUC2_PYRAB 3-isopropylmalate dehydratase large subunit 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=leuC2 PE=3 SV=1 146 492 6.0E-26
sp|Q0HZT2|LEUC_SHESR 3-isopropylmalate dehydratase large subunit OS=Shewanella sp. (strain MR-7) GN=leuC PE=3 SV=1 46 463 6.0E-26
sp|Q9RTY9|LEUC1_DEIRA 3-isopropylmalate dehydratase large subunit 1 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuC1 PE=3 SV=1 135 462 7.0E-26
sp|A4Y2M2|LEUC_SHEPC 3-isopropylmalate dehydratase large subunit OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=leuC PE=3 SV=1 44 463 7.0E-26
sp|B9IUZ2|LEUC_BACCQ 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain Q1) GN=leuC PE=3 SV=1 148 476 7.0E-26
sp|B7HKC6|LEUC_BACC7 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain AH187) GN=leuC PE=3 SV=1 148 476 7.0E-26
sp|A3CZK7|LEUC_SHEB5 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=leuC PE=3 SV=1 44 463 7.0E-26
sp|A6VQL0|LEUC_ACTSZ 3-isopropylmalate dehydratase large subunit OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=leuC PE=3 SV=1 148 476 7.0E-26
sp|Q7V336|LEUC_PROMP 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=leuC PE=3 SV=1 131 489 8.0E-26
sp|B8CM41|LEUC_SHEPW 3-isopropylmalate dehydratase large subunit OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=leuC PE=3 SV=1 40 476 8.0E-26
sp|Q1AZC4|LEUC1_RUBXD 3-isopropylmalate dehydratase large subunit 1 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuC1 PE=3 SV=1 40 486 9.0E-26
sp|Q3Z5T8|LEUC_SHISS 3-isopropylmalate dehydratase large subunit OS=Shigella sonnei (strain Ss046) GN=leuC PE=3 SV=1 40 463 9.0E-26
sp|A4FMP2|LEUC_SACEN 3-isopropylmalate dehydratase large subunit OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=leuC PE=3 SV=1 131 487 9.0E-26
sp|A9VLG9|LEUC_BACWK 3-isopropylmalate dehydratase large subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=leuC PE=3 SV=1 148 476 9.0E-26
sp|O59391|LEUC_PYRHO 3-isopropylmalate dehydratase large subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=leuC PE=3 SV=1 135 503 1.0E-25
sp|B0USF4|LEUC_HISS2 3-isopropylmalate dehydratase large subunit OS=Histophilus somni (strain 2336) GN=leuC PE=3 SV=1 38 476 1.0E-25
sp|Q0I2G3|LEUC_HAES1 3-isopropylmalate dehydratase large subunit OS=Haemophilus somnus (strain 129Pt) GN=leuC PE=3 SV=1 38 476 1.0E-25
sp|A8FP33|LEUC_CAMJ8 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=leuC PE=3 SV=1 40 491 1.0E-25
sp|C1EMB1|LEUC_BACC3 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain 03BB102) GN=leuC PE=3 SV=1 148 476 1.0E-25
sp|B2JQE1|LEUC_BURP8 3-isopropylmalate dehydratase large subunit OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=leuC PE=3 SV=1 40 476 1.0E-25
sp|B0TQM2|LEUC_SHEHH 3-isopropylmalate dehydratase large subunit OS=Shewanella halifaxensis (strain HAW-EB4) GN=leuC PE=3 SV=1 40 476 1.0E-25
sp|Q5LX06|LEUC_RUEPO 3-isopropylmalate dehydratase large subunit OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=leuC PE=3 SV=1 40 489 1.0E-25
sp|Q65V07|LEUC2_MANSM 3-isopropylmalate dehydratase large subunit 2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuC2 PE=3 SV=1 148 476 1.0E-25
sp|B8E4K6|LEUC_SHEB2 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS223) GN=leuC PE=3 SV=1 44 463 1.0E-25
sp|Q57SN1|LEUC2_SALCH 3-isopropylmalate dehydratase large subunit 2 OS=Salmonella choleraesuis (strain SC-B67) GN=leuC2 PE=3 SV=1 40 476 1.0E-25
sp|B7IN95|LEUC_BACC2 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain G9842) GN=leuC PE=3 SV=1 148 476 1.0E-25
sp|Q8U0C0|LEUC2_PYRFU 3-isopropylmalate dehydratase large subunit 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=leuC2 PE=3 SV=1 146 492 2.0E-25
sp|Q32K22|LEUC_SHIDS 3-isopropylmalate dehydratase large subunit OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=leuC PE=3 SV=1 40 463 2.0E-25
sp|Q81G10|LEUC_BACCR 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=leuC PE=3 SV=1 148 476 2.0E-25
sp|Q5WEN5|LEUC_BACSK 3-isopropylmalate dehydratase large subunit OS=Bacillus clausii (strain KSM-K16) GN=leuC PE=3 SV=1 40 476 2.0E-25
sp|B0BS44|LEUC_ACTPJ 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=leuC PE=3 SV=1 140 476 2.0E-25
sp|A1VRR0|LEUC_POLNA 3-isopropylmalate dehydratase large subunit OS=Polaromonas naphthalenivorans (strain CJ2) GN=leuC PE=3 SV=1 40 476 2.0E-25
sp|Q9K8F0|LEUC_BACHD 3-isopropylmalate dehydratase large subunit OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=leuC PE=3 SV=1 131 486 2.0E-25
sp|Q7VDT0|LEUC_PROMA 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=leuC PE=3 SV=1 131 489 2.0E-25
sp|B4F196|LEUC_PROMH 3-isopropylmalate dehydratase large subunit OS=Proteus mirabilis (strain HI4320) GN=leuC PE=3 SV=1 44 463 2.0E-25
sp|Q821C2|LEUC_SHIFL 3-isopropylmalate dehydratase large subunit OS=Shigella flexneri GN=leuC PE=3 SV=1 40 463 2.0E-25
sp|Q0T8C6|LEUC_SHIF8 3-isopropylmalate dehydratase large subunit OS=Shigella flexneri serotype 5b (strain 8401) GN=leuC PE=3 SV=1 40 463 2.0E-25
sp|A8M5I3|LEUC_SALAI 3-isopropylmalate dehydratase large subunit OS=Salinispora arenicola (strain CNS-205) GN=leuC PE=3 SV=1 138 486 2.0E-25
sp|B7JFY7|LEUC_BACC0 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain AH820) GN=leuC PE=3 SV=1 148 476 2.0E-25
sp|Q81T66|LEUC_BACAN 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis GN=leuC PE=3 SV=1 148 476 2.0E-25
sp|C3L9Q5|LEUC_BACAC 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=leuC PE=3 SV=1 148 476 2.0E-25
sp|C3P4Z8|LEUC_BACAA 3-isopropylmalate dehydratase large subunit OS=Bacillus anthracis (strain A0248) GN=leuC PE=3 SV=1 148 476 2.0E-25
sp|B7UIC2|LEUC_ECO27 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=leuC PE=3 SV=1 40 463 2.0E-25
sp|B1KKZ2|LEUC_SHEWM 3-isopropylmalate dehydratase large subunit OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=leuC PE=3 SV=1 40 476 2.0E-25
sp|B1IRA6|LEUC_ECOLC 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=leuC PE=3 SV=1 40 463 2.0E-25
sp|A7ZW23|LEUC_ECOHS 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O9:H4 (strain HS) GN=leuC PE=3 SV=1 40 463 2.0E-25
sp|B5YZA8|LEUC_ECO5E 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=leuC PE=3 SV=1 40 463 2.0E-25
sp|Q8XA00|LEUC_ECO57 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O157:H7 GN=leuC PE=3 SV=3 40 463 2.0E-25
sp|Q8F4E6|LEUC_LEPIN 3-isopropylmalate dehydratase large subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=leuC PE=3 SV=1 141 486 2.0E-25
sp|Q72RC4|LEUC_LEPIC 3-isopropylmalate dehydratase large subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=leuC PE=3 SV=1 141 486 2.0E-25
sp|B2U279|LEUC_SHIB3 3-isopropylmalate dehydratase large subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=leuC PE=3 SV=1 40 463 3.0E-25
sp|Q1RGC5|LEUC_ECOUT 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=leuC PE=3 SV=1 40 463 3.0E-25
sp|B1LG09|LEUC_ECOSM 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=leuC PE=3 SV=1 40 463 3.0E-25
sp|B6HZ52|LEUC_ECOSE 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain SE11) GN=leuC PE=3 SV=1 40 463 3.0E-25
sp|P0A6A6|LEUC_ECOLI 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain K12) GN=leuC PE=1 SV=2 40 463 3.0E-25
sp|P0A6A7|LEUC_ECOL6 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=leuC PE=3 SV=2 40 463 3.0E-25
sp|Q0TLR7|LEUC_ECOL5 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=leuC PE=3 SV=1 40 463 3.0E-25
sp|A1A7C0|LEUC_ECOK1 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O1:K1 / APEC GN=leuC PE=3 SV=1 40 463 3.0E-25
sp|C4ZPZ5|LEUC_ECOBW 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=leuC PE=3 SV=1 40 463 3.0E-25
sp|B7M117|LEUC_ECO8A 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O8 (strain IAI1) GN=leuC PE=3 SV=1 40 463 3.0E-25
sp|B7MNT0|LEUC_ECO81 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O81 (strain ED1a) GN=leuC PE=3 SV=1 40 463 3.0E-25
sp|B7NHI0|LEUC_ECO7I 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=leuC PE=3 SV=1 40 463 3.0E-25
sp|B7MAJ7|LEUC_ECO45 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=leuC PE=3 SV=1 40 463 3.0E-25
sp|A9KY15|LEUC_SHEB9 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS195) GN=leuC PE=3 SV=1 44 463 3.0E-25
sp|A6WIB7|LEUC_SHEB8 3-isopropylmalate dehydratase large subunit OS=Shewanella baltica (strain OS185) GN=leuC PE=3 SV=1 44 463 3.0E-25
sp|Q5HS78|LEUC_CAMJR 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni (strain RM1221) GN=leuC PE=3 SV=1 40 491 3.0E-25
sp|Q9PLW1|LEUC_CAMJE 3-isopropylmalate dehydratase large subunit OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=leuC PE=3 SV=1 40 491 3.0E-25
sp|Q8A6L7|LEUC_BACTN 3-isopropylmalate dehydratase large subunit OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=leuC PE=3 SV=1 40 476 3.0E-25
sp|Q8G4W2|LEUC_BIFLO 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum (strain NCC 2705) GN=leuC PE=3 SV=1 40 463 3.0E-25
sp|B3DPI2|LEUC_BIFLD 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium longum (strain DJO10A) GN=leuC PE=3 SV=1 40 463 3.0E-25
sp|Q5HMF7|LEUC_STAEQ 3-isopropylmalate dehydratase large subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=leuC PE=3 SV=1 131 476 3.0E-25
sp|B7LWE0|LEUC_ESCF3 3-isopropylmalate dehydratase large subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=leuC PE=3 SV=1 40 463 3.0E-25
sp|C5CSH5|LEUC_VARPS 3-isopropylmalate dehydratase large subunit OS=Variovorax paradoxus (strain S110) GN=leuC PE=3 SV=1 40 476 3.0E-25
sp|A4X4C8|LEUC_SALTO 3-isopropylmalate dehydratase large subunit OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=leuC PE=3 SV=1 138 486 3.0E-25
sp|B9KMK4|LEUC_RHOSK 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=leuC PE=3 SV=1 40 500 3.0E-25
sp|A7GMU3|LEUC_BACCN 3-isopropylmalate dehydratase large subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=leuC PE=3 SV=1 141 476 3.0E-25
sp|B7N7U7|LEUC_ECOLU 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=leuC PE=3 SV=1 40 463 4.0E-25
sp|A3MYL1|LEUC_ACTP2 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=leuC PE=3 SV=1 140 476 4.0E-25
sp|Q6HLF1|LEUC_BACHK 3-isopropylmalate dehydratase large subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=leuC PE=3 SV=1 148 476 4.0E-25
sp|A6T4L7|LEUC_KLEP7 3-isopropylmalate dehydratase large subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=leuC PE=3 SV=1 40 463 4.0E-25
sp|A7MIC7|LEUC_CROS8 3-isopropylmalate dehydratase large subunit OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=leuC PE=3 SV=1 40 463 4.0E-25
sp|B0KF81|LEUC_PSEPG 3-isopropylmalate dehydratase large subunit OS=Pseudomonas putida (strain GB-1) GN=leuC PE=3 SV=1 148 476 5.0E-25
sp|B7HHF7|LEUC_BACC4 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain B4264) GN=leuC PE=3 SV=1 148 476 6.0E-25
sp|Q88LE8|LEUC_PSEPK 3-isopropylmalate dehydratase large subunit OS=Pseudomonas putida (strain KT2440) GN=leuC PE=3 SV=1 148 476 6.0E-25
sp|B8DVN0|LEUC_BIFA0 3-isopropylmalate dehydratase large subunit OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=leuC PE=3 SV=1 39 463 6.0E-25
sp|B1ZKX6|LEUC_METPB 3-isopropylmalate dehydratase large subunit OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=leuC PE=3 SV=1 40 476 6.0E-25
sp|O53166|ACNA_MYCTU Aconitate hydratase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acn PE=1 SV=1 303 765 6.0E-25
sp|Q63JK9|LEUC_BURPS 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain K96243) GN=leuC PE=3 SV=1 40 463 7.0E-25
sp|A3NM77|LEUC_BURP6 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 668) GN=leuC PE=3 SV=1 40 463 7.0E-25
sp|Q3JKG6|LEUC_BURP1 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 1710b) GN=leuC PE=3 SV=2 40 463 7.0E-25
sp|A3P7N9|LEUC_BURP0 3-isopropylmalate dehydratase large subunit OS=Burkholderia pseudomallei (strain 1106a) GN=leuC PE=3 SV=1 40 463 7.0E-25
sp|P58946|LEUC_CORGL 3-isopropylmalate dehydratase large subunit OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=leuC PE=2 SV=1 131 487 8.0E-25
sp|B7L4J3|LEUC_ECO55 3-isopropylmalate dehydratase large subunit OS=Escherichia coli (strain 55989 / EAEC) GN=leuC PE=3 SV=1 40 463 8.0E-25
sp|Q11NN8|LEUC_CYTH3 3-isopropylmalate dehydratase large subunit OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=leuC PE=3 SV=1 131 486 9.0E-25
sp|A1UZ32|LEUC_BURMS 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain SAVP1) GN=leuC PE=3 SV=1 40 463 9.0E-25
sp|Q62AI6|LEUC_BURMA 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain ATCC 23344) GN=leuC PE=3 SV=1 40 463 9.0E-25
sp|A2S127|LEUC_BURM9 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain NCTC 10229) GN=leuC PE=3 SV=1 40 463 9.0E-25
sp|A3MBT5|LEUC_BURM7 3-isopropylmalate dehydratase large subunit OS=Burkholderia mallei (strain NCTC 10247) GN=leuC PE=3 SV=1 40 463 9.0E-25
sp|B3GZY1|LEUC_ACTP7 3-isopropylmalate dehydratase large subunit OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=leuC PE=3 SV=1 140 476 1.0E-24
sp|A6W7Q7|LEUC_KINRD 3-isopropylmalate dehydratase large subunit OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=leuC PE=3 SV=1 122 487 1.0E-24
sp|A4QDS8|LEUC_CORGB 3-isopropylmalate dehydratase large subunit OS=Corynebacterium glutamicum (strain R) GN=leuC PE=3 SV=1 131 487 1.0E-24
sp|Q1GDM6|LEUC_RUEST 3-isopropylmalate dehydratase large subunit OS=Ruegeria sp. (strain TM1040) GN=leuC PE=3 SV=1 40 463 1.0E-24
sp|Q2T7H8|LEUC_BURTA 3-isopropylmalate dehydratase large subunit OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=leuC PE=3 SV=1 40 463 1.0E-24
sp|Q2VZV4|LEUC_MAGSA 3-isopropylmalate dehydratase large subunit OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=leuC PE=3 SV=1 131 489 1.0E-24
sp|Q0VPI0|LEUC_ALCBS 3-isopropylmalate dehydratase large subunit OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=leuC PE=3 SV=2 122 476 1.0E-24
sp|A9GL99|LEUC_SORC5 3-isopropylmalate dehydratase large subunit OS=Sorangium cellulosum (strain So ce56) GN=leuC PE=3 SV=1 148 486 1.0E-24
sp|A2C088|LEUC_PROM1 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain NATL1A) GN=leuC PE=3 SV=1 126 489 1.0E-24
sp|B5Y1W4|LEUC_KLEP3 3-isopropylmalate dehydratase large subunit OS=Klebsiella pneumoniae (strain 342) GN=leuC PE=3 SV=1 40 463 1.0E-24
sp|A2BP55|LEUC_PROMS 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain AS9601) GN=leuC PE=3 SV=1 148 489 1.0E-24
sp|Q4WBR0|ACON3_ASPFU Putative aconitate hydratase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acoC PE=2 SV=1 132 698 1.0E-24
sp|Q63DX6|LEUC_BACCZ 3-isopropylmalate dehydratase large subunit OS=Bacillus cereus (strain ZK / E33L) GN=leuC PE=3 SV=1 148 476 1.0E-24
sp|Q6AFK7|LEUC_LEIXX 3-isopropylmalate dehydratase large subunit OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=leuC PE=3 SV=1 131 487 1.0E-24
sp|Q3IZI8|LEUC_RHOS4 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=leuC PE=3 SV=1 40 489 1.0E-24
sp|Q9EVG2|LEUC_BUCML 3-isopropylmalate dehydratase large subunit (Fragment) OS=Buchnera aphidicola subsp. Macrosiphoniella ludovicianae GN=leuC PE=3 SV=1 141 462 1.0E-24
sp|Q46HB8|LEUC_PROMT 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain NATL2A) GN=leuC PE=3 SV=1 126 489 2.0E-24
sp|A7ZHG4|LEUC_ECO24 3-isopropylmalate dehydratase large subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=leuC PE=3 SV=1 40 463 2.0E-24
sp|A3PMQ9|LEUC_RHOS1 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=leuC PE=3 SV=1 40 489 2.0E-24
sp|A8FQ85|LEUC_SHESH 3-isopropylmalate dehydratase large subunit OS=Shewanella sediminis (strain HAW-EB3) GN=leuC PE=3 SV=1 40 476 2.0E-24
sp|Q3SHL1|LEUC_THIDA 3-isopropylmalate dehydratase large subunit OS=Thiobacillus denitrificans (strain ATCC 25259) GN=leuC PE=3 SV=1 40 463 2.0E-24
sp|Q126M9|LEUC_POLSJ 3-isopropylmalate dehydratase large subunit OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=leuC PE=3 SV=1 40 476 2.0E-24
sp|Q8XXX3|LEUC_RALSO 3-isopropylmalate dehydratase large subunit OS=Ralstonia solanacearum (strain GMI1000) GN=leuC PE=3 SV=1 40 476 2.0E-24
sp|Q46YV7|LEUC_CUPPJ 3-isopropylmalate dehydratase large subunit OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=leuC PE=3 SV=1 148 476 2.0E-24
sp|P48573|LEUC_BUCRP 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Rhopalosiphum padi GN=leuC PE=3 SV=1 40 486 2.0E-24
sp|B9MDK8|LEUC_ACIET 3-isopropylmalate dehydratase large subunit OS=Acidovorax ebreus (strain TPSY) GN=leuC PE=3 SV=1 148 476 2.0E-24
sp|Q4JVM4|ACNA_CORJK Aconitate hydratase A OS=Corynebacterium jeikeium (strain K411) GN=acn PE=3 SV=1 364 767 3.0E-24
sp|P80858|LEUC_BACSU 3-isopropylmalate dehydratase large subunit OS=Bacillus subtilis (strain 168) GN=leuC PE=1 SV=1 40 486 3.0E-24
sp|A7Z7B6|LEUC_BACMF 3-isopropylmalate dehydratase large subunit OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=leuC PE=3 SV=1 40 486 3.0E-24
sp|A1WAS7|LEUC_ACISJ 3-isopropylmalate dehydratase large subunit OS=Acidovorax sp. (strain JS42) GN=leuC PE=3 SV=1 148 476 3.0E-24
sp|C1F700|LEUC_ACIC5 3-isopropylmalate dehydratase large subunit OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=leuC PE=3 SV=1 100 486 3.0E-24
sp|A8G9Q9|LEUC_SERP5 3-isopropylmalate dehydratase large subunit OS=Serratia proteamaculans (strain 568) GN=leuC PE=3 SV=1 40 463 3.0E-24
sp|B9JCN5|LEUC_AGRRK 3-isopropylmalate dehydratase large subunit OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=leuC PE=3 SV=1 40 463 3.0E-24
sp|Q1H0L4|LEUC_METFK 3-isopropylmalate dehydratase large subunit OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=leuC PE=3 SV=1 131 476 4.0E-24
sp|O85065|LEUC_BUCAP 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=leuC PE=3 SV=1 40 486 4.0E-24
sp|A4WNV5|LEUC_RHOS5 3-isopropylmalate dehydratase large subunit OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=leuC PE=3 SV=1 40 489 4.0E-24
sp|Q0AT09|LEUC_MARMM 3-isopropylmalate dehydratase large subunit OS=Maricaulis maris (strain MCS10) GN=leuC PE=3 SV=1 133 463 4.0E-24
sp|A0L8J4|LEUC_MAGMM 3-isopropylmalate dehydratase large subunit OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=leuC PE=3 SV=1 148 476 6.0E-24
sp|A6VX34|LEUC_MARMS 3-isopropylmalate dehydratase large subunit OS=Marinomonas sp. (strain MWYL1) GN=leuC PE=3 SV=1 148 463 6.0E-24
sp|C5B7R2|LEUC_EDWI9 3-isopropylmalate dehydratase large subunit OS=Edwardsiella ictaluri (strain 93-146) GN=leuC PE=3 SV=1 116 463 6.0E-24
sp|B2I359|LEUC_ACIBC 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain ACICU) GN=leuC PE=3 SV=1 40 476 6.0E-24
sp|P58945|LEUC_BUCPS 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Pemphigus spyrothecae GN=leuC PE=3 SV=1 141 462 6.0E-24
sp|A9BDM7|LEUC_PROM4 3-isopropylmalate dehydratase large subunit OS=Prochlorococcus marinus (strain MIT 9211) GN=leuC PE=3 SV=1 148 489 6.0E-24
sp|A1SLW5|LEUC_NOCSJ 3-isopropylmalate dehydratase large subunit OS=Nocardioides sp. (strain BAA-499 / JS614) GN=leuC PE=3 SV=1 131 487 6.0E-24
sp|Q65GJ0|LEUC_BACLD 3-isopropylmalate dehydratase large subunit OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=leuC PE=3 SV=1 40 486 6.0E-24
sp|Q6FEW0|LEUC_ACIAD 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=leuC PE=3 SV=1 109 476 7.0E-24
sp|Q6NHL0|LEUC_CORDI 3-isopropylmalate dehydratase large subunit OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=leuC PE=3 SV=1 148 487 7.0E-24
sp|A3M1S8|LEUC_ACIBT 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=leuC PE=3 SV=2 40 476 7.0E-24
sp|A8H999|LEUC_SHEPA 3-isopropylmalate dehydratase large subunit OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=leuC PE=3 SV=1 40 476 7.0E-24
sp|A0KGM7|LEUC_AERHH 3-isopropylmalate dehydratase large subunit OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=leuC PE=3 SV=1 116 463 8.0E-24
sp|Q2SJD8|LEUC_HAHCH 3-isopropylmalate dehydratase large subunit OS=Hahella chejuensis (strain KCTC 2396) GN=leuC PE=3 SV=1 109 463 8.0E-24
sp|A8Z4W2|LEUC_STAAT 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=leuC PE=3 SV=1 131 462 8.0E-24
sp|P63436|LEUC_STAAN 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain N315) GN=leuC PE=3 SV=1 131 462 8.0E-24
sp|P63435|LEUC_STAAM 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=leuC PE=3 SV=1 131 462 8.0E-24
sp|A6QIQ5|LEUC_STAAE 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain Newman) GN=leuC PE=3 SV=1 131 462 8.0E-24
sp|Q5HEE2|LEUC_STAAC 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain COL) GN=leuC PE=3 SV=1 131 462 8.0E-24
sp|Q2YUF0|LEUC_STAAB 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=leuC PE=3 SV=1 131 462 8.0E-24
sp|A5IUK5|LEUC_STAA9 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain JH9) GN=leuC PE=3 SV=1 131 462 8.0E-24
sp|Q2FWK1|LEUC_STAA8 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain NCTC 8325) GN=leuC PE=3 SV=1 131 462 8.0E-24
sp|Q2FF65|LEUC_STAA3 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain USA300) GN=leuC PE=3 SV=1 131 462 8.0E-24
sp|A6U3E4|LEUC_STAA2 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain JH1) GN=leuC PE=3 SV=1 131 462 8.0E-24
sp|A7X4N3|LEUC_STAA1 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=leuC PE=3 SV=1 131 462 8.0E-24
sp|B7I4E1|LEUC_ACIB5 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain AB0057) GN=leuC PE=3 SV=1 40 476 8.0E-24
sp|A3QIN8|LEUC_SHELP 3-isopropylmalate dehydratase large subunit OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=leuC PE=3 SV=1 40 463 8.0E-24
sp|B7H0T7|LEUC_ACIB3 3-isopropylmalate dehydratase large subunit OS=Acinetobacter baumannii (strain AB307-0294) GN=leuC PE=3 SV=1 40 476 8.0E-24
sp|Q1ICW0|LEUC_PSEE4 3-isopropylmalate dehydratase large subunit OS=Pseudomonas entomophila (strain L48) GN=leuC PE=3 SV=1 148 476 8.0E-24
sp|Q5WPZ8|LEUC_BUCCC 3-isopropylmalate dehydratase large subunit OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=leuC PE=3 SV=1 148 486 9.0E-24
sp|A8LKJ1|LEUC_DINSH 3-isopropylmalate dehydratase large subunit OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=leuC PE=3 SV=1 40 489 9.0E-24
sp|A0QX20|ACNA_MYCS2 Aconitate hydratase A OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acnA PE=1 SV=1 364 765 1.0E-23
sp|O86534|LEUC_STRCO 3-isopropylmalate dehydratase large subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=leuC PE=3 SV=1 138 486 1.0E-23
sp|Q5M406|LEUC_STRT2 3-isopropylmalate dehydratase large subunit OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=leuC PE=3 SV=2 138 486 1.0E-23
sp|P58947|LEUC_STAAW 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain MW2) GN=leuC PE=3 SV=1 131 476 1.0E-23
sp|Q6G7P9|LEUC_STAAS 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain MSSA476) GN=leuC PE=3 SV=1 131 476 1.0E-23
sp|B1VZ03|LEUC_STRGG 3-isopropylmalate dehydratase large subunit OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=leuC PE=3 SV=1 138 486 1.0E-23
sp|A8ALM7|LEUC_CITK8 3-isopropylmalate dehydratase large subunit OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=leuC PE=3 SV=1 40 463 1.0E-23
sp|A4W6H7|LEUC_ENT38 3-isopropylmalate dehydratase large subunit OS=Enterobacter sp. (strain 638) GN=leuC PE=3 SV=1 40 463 1.0E-23
sp|Q1MAJ9|LEUC_RHIL3 3-isopropylmalate dehydratase large subunit OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=leuC PE=3 SV=1 40 463 1.0E-23
sp|Q11CQ6|LEUC_CHESB 3-isopropylmalate dehydratase large subunit OS=Chelativorans sp. (strain BNC1) GN=leuC PE=3 SV=1 122 463 1.0E-23
sp|Q0A9B0|LEUC_ALKEH 3-isopropylmalate dehydratase large subunit OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=leuC PE=3 SV=1 148 463 1.0E-23
sp|Q03KB3|LEUC_STRTD 3-isopropylmalate dehydratase large subunit OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=leuC PE=3 SV=1 138 476 1.0E-23
sp|Q6GF14|LEUC_STAAR 3-isopropylmalate dehydratase large subunit OS=Staphylococcus aureus (strain MRSA252) GN=leuC PE=3 SV=1 131 481 2.0E-23
sp|A7HT10|LEUC_PARL1 3-isopropylmalate dehydratase large subunit OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=leuC PE=3 SV=1 131 489 2.0E-23
sp|A1S2E2|LEUC_SHEAM 3-isopropylmalate dehydratase large subunit OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=leuC PE=3 SV=1 141 463 2.0E-23
sp|A0QX20|ACNA_MYCS2 Aconitate hydratase A OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acnA PE=1 SV=1 65 356 1.0E-22
sp|Q8FTA8|ACNA_COREF Aconitate hydratase A OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=acn PE=3 SV=2 364 768 9.0E-22
sp|O53166|ACNA_MYCTU Aconitate hydratase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acn PE=1 SV=1 65 355 2.0E-20
sp|Q8NQ98|ACNA_CORGL Aconitate hydratase A OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=acn PE=1 SV=2 364 768 3.0E-20
sp|Q6NH63|ACNA_CORDI Aconitate hydratase A OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=acn PE=3 SV=1 364 765 2.0E-19
sp|P49608|ACOC_CUCMA Aconitate hydratase, cytoplasmic OS=Cucurbita maxima PE=2 SV=1 621 765 2.0E-09
sp|Q90875|ACOC_CHICK Cytoplasmic aconitate hydratase OS=Gallus gallus GN=ACO1 PE=2 SV=1 628 767 4.0E-07
sp|Q9RTN7|ACNA_DEIRA Aconitate hydratase A OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=acn PE=1 SV=1 619 734 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1181
MASMRRAAASSASTLRPIYQRLLKSYNAARNILGRDRRFTLTEKLLYSHVAHVESSSLLSSGSPLRLLPDRVNMQ
DASAQMALLQLLACGPSARAALPASIHCDHLIVGSQGAEDDLAAGRETNSEVFAFLETAARRFGLDFWPPGAGII
HQTVLENYALPGLMMLGTDSHSPNAGGMATFTVGVGGADAVEALVGAPWELRRPAVHGVELVGKLSGWASPKDVI
LKLAGKLSVRGGTGSVLEYFGPGVESLSLTGMATIANMGAEVGATTSVFPYTASTARYLCSTNRNWAVDTITELS
NLPNGLNFQADTDASYDQVTRIDLSTLEPHINGPFTPDISTPLSDFKENVMEKGYPEKLSASLIGSCTNSSYEDM
TRVQSLLRQAKDVGLKPKVDLFVTPGSEQIRATLERDGTIQELEAAGAVLLANACGPCIGQWRRRDGVDDGQTNA
ILSSYNRNFRGRNDGNPETMNFLASPEIVTAMAFAGTTTFNPVTDSLTTPTGEEFRFDPPSGLEGPPTNFTPGRS
TLSVQTSPADESIAVAISPNSSRLALLEPFAPFPTRDLSHLRVLIKIRGKCTTDTISAAGPWLKYKGHLSNISAN
TLNTAVNAATDEVNAAYDVDGTRHTIPDLARLWKARGTQWLVVAEDNYGEGSAREHAALQPRFLGAALVLAKSFA
RIHETNLKKQGVVPLTFDQEADYHRIEACDRVDTLGLHQMLLNGGQGTVHLRVTKKDGHELRIPTRHTVSKDQAA
FILAGSVLNYMINNIGSS
Coding >Ophio5|1181
ATGGCGAGCATGCGCCGGGCCGCGGCGTCGTCCGCCTCGACGCTACGACCAATCTACCAGCGACTGCTCAAAAGC
TACAACGCAGCGCGAAACATTCTCGGACGCGACCGACGGTTCACATTAACGGAAAAGCTCCTCTACAGCCATGTC
GCCCATGTCGAATCCTCCTCTCTCCTATCTTCAGGAAGCCCACTGCGGCTCTTACCCGACCGGGTCAATATGCAA
GACGCATCAGCGCAAATGGCGCTCCTACAACTTCTCGCATGCGGACCCTCAGCCCGAGCCGCTCTCCCGGCTAGT
ATCCATTGCGACCACCTGATTGTCGGTTCGCAAGGGGCAGAAGATGACCTCGCTGCGGGACGGGAGACGAATTCC
GAAGTCTTTGCTTTTCTGGAGACGGCCGCTCGGAGATTCGGATTGGATTTTTGGCCGCCCGGAGCGGGAATCATT
CATCAGACCGTTTTGGAGAATTATGCTCTGCCCGGGTTGATGATGCTGGGGACGGATAGTCATAGTCCTAATGCC
GGTGGCATGGCTACTTTTACTGTTGGTGTCGGCGGTGCTGATGCTGTTGAAGCGCTGGTGGGTGCGCCTTGGGAG
TTGCGTCGGCCGGCCGTTCATGGCGTTGAACTCGTCGGTAAGCTGAGTGGTTGGGCCTCGCCCAAGGATGTTATT
CTCAAGCTTGCTGGGAAGCTGTCTGTTCGAGGTGGCACTGGTTCTGTGCTGGAGTATTTTGGTCCCGGGGTTGAG
TCTCTCAGTCTCACTGGCATGGCCACCATTGCCAACATGGGGGCAGAGGTCGGTGCGACCACGTCCGTCTTCCCT
TACACCGCCTCTACGGCACGATACCTCTGCTCAACAAACCGCAACTGGGCCGTCGACACAATCACCGAACTCAGC
AACCTCCCAAACGGACTCAACTTCCAAGCCGACACCGACGCCTCTTACGACCAAGTAACACGTATCGACCTGAGC
ACACTGGAGCCACACATCAACGGGCCCTTCACACCCGATATCTCCACCCCCCTCTCCGACTTCAAAGAAAACGTC
ATGGAAAAGGGGTATCCGGAAAAGCTATCCGCCAGCCTCATCGGAAGCTGCACCAACAGTTCATACGAAGACATG
ACACGCGTCCAAAGTCTACTCCGTCAAGCCAAAGACGTCGGTCTCAAACCAAAGGTGGATCTATTCGTCACGCCC
GGTAGCGAACAGATTCGCGCGACGCTCGAACGTGACGGTACGATTCAGGAGCTTGAGGCTGCCGGGGCCGTCTTG
TTGGCTAATGCGTGTGGACCATGCATCGGTCAATGGAGACGTCGTGATGGGGTTGACGACGGCCAGACGAATGCT
ATTCTCTCGTCGTATAATCGTAACTTTCGCGGGCGGAATGATGGGAATCCGGAGACGATGAACTTCTTGGCGTCG
CCCGAGATTGTCACGGCCATGGCTTTTGCCGGAACTACGACGTTCAATCCGGTTACGGATTCACTCACCACTCCT
ACCGGCGAGGAATTCCGCTTCGACCCCCCTTCGGGCCTCGAAGGACCGCCCACCAACTTCACACCCGGCCGTTCA
ACCCTCTCGGTCCAAACGTCGCCGGCCGACGAAAGCATCGCCGTGGCCATCTCGCCCAACTCCTCCCGCCTCGCC
CTACTAGAACCGTTCGCGCCCTTTCCGACCAGGGACCTAAGCCATCTCCGGGTGCTGATCAAGATACGAGGAAAA
TGCACAACCGACACCATCTCGGCCGCAGGACCATGGCTGAAATACAAAGGACACCTATCCAACATCAGCGCCAAC
ACGCTCAACACGGCCGTCAACGCAGCCACGGACGAAGTCAACGCGGCTTATGACGTAGACGGCACGCGTCATACG
ATCCCCGACCTCGCCCGGCTATGGAAAGCCCGCGGTACGCAATGGCTCGTGGTGGCCGAAGATAACTACGGCGAG
GGCTCCGCGCGGGAACACGCTGCTTTACAGCCTAGGTTCCTCGGCGCCGCCCTCGTCCTGGCCAAGTCGTTTGCC
AGGATTCACGAGACCAATCTCAAGAAGCAGGGCGTCGTGCCGCTTACCTTTGACCAGGAGGCCGATTACCATCGC
ATCGAGGCCTGTGATCGAGTTGATACCCTGGGCTTGCATCAGATGTTGCTCAACGGTGGTCAGGGAACGGTTCAC
TTGCGCGTTACCAAGAAGGACGGCCACGAGCTGCGAATCCCCACCAGGCATACCGTTAGCAAGGACCAGGCTGCT
TTTATCCTGGCCGGGAGTGTGCTCAACTACATGATCAACAATATCGGATCTAGT
Transcript >Ophio5|1181
ATGGCGAGCATGCGCCGGGCCGCGGCGTCGTCCGCCTCGACGCTACGACCAATCTACCAGCGACTGCTCAAAAGC
TACAACGCAGCGCGAAACATTCTCGGACGCGACCGACGGTTCACATTAACGGAAAAGCTCCTCTACAGCCATGTC
GCCCATGTCGAATCCTCCTCTCTCCTATCTTCAGGAAGCCCACTGCGGCTCTTACCCGACCGGGTCAATATGCAA
GACGCATCAGCGCAAATGGCGCTCCTACAACTTCTCGCATGCGGACCCTCAGCCCGAGCCGCTCTCCCGGCTAGT
ATCCATTGCGACCACCTGATTGTCGGTTCGCAAGGGGCAGAAGATGACCTCGCTGCGGGACGGGAGACGAATTCC
GAAGTCTTTGCTTTTCTGGAGACGGCCGCTCGGAGATTCGGATTGGATTTTTGGCCGCCCGGAGCGGGAATCATT
CATCAGACCGTTTTGGAGAATTATGCTCTGCCCGGGTTGATGATGCTGGGGACGGATAGTCATAGTCCTAATGCC
GGTGGCATGGCTACTTTTACTGTTGGTGTCGGCGGTGCTGATGCTGTTGAAGCGCTGGTGGGTGCGCCTTGGGAG
TTGCGTCGGCCGGCCGTTCATGGCGTTGAACTCGTCGGTAAGCTGAGTGGTTGGGCCTCGCCCAAGGATGTTATT
CTCAAGCTTGCTGGGAAGCTGTCTGTTCGAGGTGGCACTGGTTCTGTGCTGGAGTATTTTGGTCCCGGGGTTGAG
TCTCTCAGTCTCACTGGCATGGCCACCATTGCCAACATGGGGGCAGAGGTCGGTGCGACCACGTCCGTCTTCCCT
TACACCGCCTCTACGGCACGATACCTCTGCTCAACAAACCGCAACTGGGCCGTCGACACAATCACCGAACTCAGC
AACCTCCCAAACGGACTCAACTTCCAAGCCGACACCGACGCCTCTTACGACCAAGTAACACGTATCGACCTGAGC
ACACTGGAGCCACACATCAACGGGCCCTTCACACCCGATATCTCCACCCCCCTCTCCGACTTCAAAGAAAACGTC
ATGGAAAAGGGGTATCCGGAAAAGCTATCCGCCAGCCTCATCGGAAGCTGCACCAACAGTTCATACGAAGACATG
ACACGCGTCCAAAGTCTACTCCGTCAAGCCAAAGACGTCGGTCTCAAACCAAAGGTGGATCTATTCGTCACGCCC
GGTAGCGAACAGATTCGCGCGACGCTCGAACGTGACGGTACGATTCAGGAGCTTGAGGCTGCCGGGGCCGTCTTG
TTGGCTAATGCGTGTGGACCATGCATCGGTCAATGGAGACGTCGTGATGGGGTTGACGACGGCCAGACGAATGCT
ATTCTCTCGTCGTATAATCGTAACTTTCGCGGGCGGAATGATGGGAATCCGGAGACGATGAACTTCTTGGCGTCG
CCCGAGATTGTCACGGCCATGGCTTTTGCCGGAACTACGACGTTCAATCCGGTTACGGATTCACTCACCACTCCT
ACCGGCGAGGAATTCCGCTTCGACCCCCCTTCGGGCCTCGAAGGACCGCCCACCAACTTCACACCCGGCCGTTCA
ACCCTCTCGGTCCAAACGTCGCCGGCCGACGAAAGCATCGCCGTGGCCATCTCGCCCAACTCCTCCCGCCTCGCC
CTACTAGAACCGTTCGCGCCCTTTCCGACCAGGGACCTAAGCCATCTCCGGGTGCTGATCAAGATACGAGGAAAA
TGCACAACCGACACCATCTCGGCCGCAGGACCATGGCTGAAATACAAAGGACACCTATCCAACATCAGCGCCAAC
ACGCTCAACACGGCCGTCAACGCAGCCACGGACGAAGTCAACGCGGCTTATGACGTAGACGGCACGCGTCATACG
ATCCCCGACCTCGCCCGGCTATGGAAAGCCCGCGGTACGCAATGGCTCGTGGTGGCCGAAGATAACTACGGCGAG
GGCTCCGCGCGGGAACACGCTGCTTTACAGCCTAGGTTCCTCGGCGCCGCCCTCGTCCTGGCCAAGTCGTTTGCC
AGGATTCACGAGACCAATCTCAAGAAGCAGGGCGTCGTGCCGCTTACCTTTGACCAGGAGGCCGATTACCATCGC
ATCGAGGCCTGTGATCGAGTTGATACCCTGGGCTTGCATCAGATGTTGCTCAACGGTGGTCAGGGAACGGTTCAC
TTGCGCGTTACCAAGAAGGACGGCCACGAGCTGCGAATCCCCACCAGGCATACCGTTAGCAAGGACCAGGCTGCT
TTTATCCTGGCCGGGAGTGTGCTCAACTACATGATCAACAATATCGGATCTAGTTGA
Gene >Ophio5|1181
ATGGCGGTGCGCTTCGCTTCCCTGCCCTCACCCTTTTCCCCTGTGATATTCAAACAACACAGCAGAACAAAACAG
CTAACGACGATAAGAGCATGCGCCGGGCCGCGGCGTCGTCCGCCTCGACGCTACGACCAATCTACCAGCGACTGC
TCAAAAGCTACAACGCAGCGCGAAACATTCTCGGACGCGACCGACGGTTCACATTAACGGAAAAGCTCCTCTACA
GCCATGTCGCCCATGTCGAATCCTCCTCTCTCCTATCTTCAGGAAGCCCACTGCGGCTCTTACCCGACCGGGTCA
ATATGCAAGACGCATCAGCGCAAATGGCGCTCCTACAACTTCTCGCATGCGGACCCTCAGCCCGAGCCGCTCTCC
CGGCTAGTATCCATTGCGACCACCTGATTGTCGGTTCGCAAGGGGCAGAAGATGACCTCGCTGCGGGACGGGAGA
CGAATTCCGAAGTCTTTGCTTTTCTGGAGACGGCCGCTCGGAGATTCGGATTGGATTTTTGGCCGCCCGGAGCGG
GAATCATTCATCAGACCGTTTTGGAGAATTATGCTCTGCCCGGGTTGATGATGCTGGGGACGGATAGTCATAGTC
CTAATGCCGGTGGCATGGCTACTTTTACTGTTGGTGTCGGCGGTGCTGATGCTGTTGAAGCGCTGGTGGGTGCGC
CTTGGGAGTTGCGTCGGCCGGCCGTTCATGGCGTTGAACTCGTCGGTAAGCTGAGTGGTTGGGCCTCGCCCAAGG
ATGTTATTCTCAAGCTTGCTGGGAAGCTGTCTGTTCGAGGTGGCACTGGTTCTGTGCTGGAGTATTTTGGTCCCG
GGGTTGAGTCTCTCAGTCTCACTGGCATGGCCACCATTGCCAACATGGGGTTCGTTATCTTCCAATTCCCCCCTT
TTTGCTCGCCTTCTTCTGGCTGAACTGTTCACAGGGCAGAGGTCGGTGCGACCACGTCCGTCTTCCCTTACACCG
CCTCTACGGCACGATACCTCTGCTCAACAAACCGCAACTGGGCCGTCGACACAATCACCGAACTCAGCAACCTCC
CAAACGGACTCAACTTCCAAGCCGACACCGACGCCTCTTACGACCAAGTAACACGTATCGACCTGAGCACACTGG
AGCCACACATCAACGGGCCCTTCACACCCGATATCTCCACCCCCCTCTCCGACTTCAAAGAAAACGTCATGGAAA
AGGGGTATCCGGAAAAGCTATCCGCCAGCCTCATCGGAAGCTGCACCAACAGTTCATACGAAGACATGACACGCG
TCCAAAGTCTACTCCGTCAAGCCAAAGACGTCGGTCTCAAACCAAAGGTGGATCTATTCGTCACGCCCGGTAGCG
AACAGATTCGCGCGACGCTCGAACGTGACGGTACGATTCAGGAGCTTGAGGCTGCCGGGGCCGTCTTGTTGGCTA
ATGCGTGTGGACCATGCATCGGTCAATGGAGACGTCGTGATGGGGTTGACGACGGCCAGACGAATGCTATTCTCT
CGTCGTATAATCGTAACTTTCGCGGGCGGAATGATGGGAATCCGGAGACGATGAACTTCTTGGCGTCGCCCGAGA
TTGTCACGGCCATGGCTTTTGCCGGAACTACGACGTTCAATCCGGTTACGGATTCACTCACCACTCCTACCGGCG
AGGAATTCCGCTTCGACCCCCCTTCGGGCCTCGAAGGACCGCCCACCAACTTCACACCCGGCCGTTCAACCCTCT
CGGTCCAAACGTCGCCGGCCGACGAAAGCATCGCCGTGGCCATCTCGCCCAACTCCTCCCGCCTCGCCCTACTAG
AACCGTTCGCGCCCTTTCCGACCAGGGACCTAAGCCATCTCCGGGTGCTGATCAAGATACGAGGAAAATGCACAA
CCGACACCATCTCGGCCGCAGGACCATGGCTGAAATACAAAGGACACCTATCCAACATCAGCGCCAACACGCTCA
ACACGGCCGTCAACGCAGCCACGGACGAAGTCAACGCGGCTTATGACGTAGACGGCACGCGTCATACGATCCCCG
ACCTCGCCCGGCTATGGAAAGCCCGCGGTACGCAATGGCTCGTGGTGGCCGAAGATAACTACGGCGAGGGCTCCG
CGCGGGAACACGCTGCTTTACAGCCTAGGTTCCTCGGCGCCGCCCTCGTCCTGGCCAAGTCGTTTGCCAGGATTC
ACGAGACCAATCTCAAGAAGCAGGGCGTCGTGCCGCTTACCTTTGACCAGGAGGCCGATTACCATCGCATCGAGG
CCTGTGATCGAGTTGATACCCTGGGCTTGCATCAGATGTTGCTCAACGGTGGTCAGGGAACGGTTCACTTGCGCG
TTACCAAGAAGGACGGCCACGAGCTGCGAATCCCCACCAGGCATACCGTTAGCAAGGACCAGGCTGCTTTTATCC
TGGCCGGGAGTGTGCTCAACTACATGATCAACAATATCGGATCTAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail