© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophio5|1177 |
| Gene name | |
| Location | scaffold_138:13996..15789 |
| Strand | - |
| Gene length (bp) | 1793 |
| Transcript length (bp) | 1581 |
| Coding sequence length (bp) | 1578 |
| Protein length (aa) | 526 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00067 | p450 | Cytochrome P450 | 7.2E-64 | 92 | 500 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q12608|STCB_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 | 85 | 507 | 1.0E-57 |
| sp|P17549|CP53_ASPNG | Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 | 92 | 502 | 4.0E-40 |
| sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 92 | 474 | 6.0E-40 |
| sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 92 | 474 | 6.0E-40 |
| sp|Q12609|STCF_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 | 92 | 498 | 4.0E-39 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q12608|STCB_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 | 85 | 507 | 1.0E-57 |
| sp|P17549|CP53_ASPNG | Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 | 92 | 502 | 4.0E-40 |
| sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 92 | 474 | 6.0E-40 |
| sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 92 | 474 | 6.0E-40 |
| sp|Q12609|STCF_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 | 92 | 498 | 4.0E-39 |
| sp|Q12732|AVNA_ASPPA | Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 | 92 | 498 | 2.0E-36 |
| sp|A1DA60|FTMC_NEOFI | Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 | 92 | 474 | 2.0E-34 |
| sp|O13317|TRI11_FUSSP | Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 | 92 | 480 | 2.0E-33 |
| sp|Q12645|PID9_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 | 92 | 474 | 5.0E-31 |
| sp|Q9UW95|AFLL_ASPPA | Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 | 92 | 474 | 7.0E-31 |
| sp|P38364|PID6_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 | 92 | 474 | 1.0E-29 |
| sp|P24463|CP3AC_CANLF | Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 | 147 | 474 | 4.0E-29 |
| sp|Q00707|STCL_EMENI | Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 | 92 | 474 | 5.0E-29 |
| sp|P79102|CP3AS_BOVIN | Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 | 147 | 474 | 4.0E-28 |
| sp|Q29496|CP3AO_SHEEP | Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 | 147 | 474 | 4.0E-28 |
| sp|P08684|CP3A4_HUMAN | Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 | 147 | 474 | 7.0E-28 |
| sp|Q64481|CP3AG_MOUSE | Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 | 104 | 474 | 4.0E-27 |
| sp|P11707|CP3A6_RABIT | Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 | 147 | 474 | 7.0E-27 |
| sp|P79401|CP3AT_PIG | Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 | 147 | 474 | 1.0E-26 |
| sp|Q64459|CP3AB_MOUSE | Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 | 104 | 474 | 2.0E-26 |
| sp|Q64417|CP3AE_CAVPO | Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 | 147 | 474 | 4.0E-26 |
| sp|Q64409|CP3AH_CAVPO | Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 | 147 | 474 | 4.0E-26 |
| sp|P24462|CP3A7_HUMAN | Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 | 147 | 474 | 7.0E-26 |
| sp|O18993|CP3AL_CALJA | Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 | 147 | 474 | 2.0E-25 |
| sp|Q64148|CP3AA_MESAU | Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 | 147 | 474 | 1.0E-24 |
| sp|P05183|CP3A2_RAT | Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 | 147 | 474 | 3.0E-24 |
| sp|Q9HB55|CP343_HUMAN | Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 | 147 | 469 | 3.0E-24 |
| sp|Q9JMA7|CP341_MOUSE | Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 | 147 | 474 | 5.0E-24 |
| sp|Q64406|CP3AF_CAVPO | Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 | 147 | 474 | 5.0E-24 |
| sp|Q64464|CP3AD_MOUSE | Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 | 147 | 474 | 9.0E-24 |
| sp|P33268|CP3A8_MACFA | Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 | 147 | 474 | 1.0E-23 |
| sp|Q64581|CP3AI_RAT | Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 | 147 | 467 | 1.0E-23 |
| sp|P04800|CP3A1_RAT | Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 | 147 | 474 | 2.0E-23 |
| sp|P20815|CP3A5_HUMAN | Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 | 147 | 474 | 3.0E-23 |
| sp|O09158|CP3AP_MOUSE | Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 | 91 | 467 | 5.0E-23 |
| sp|O70537|CP3AV_MESAU | Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 | 147 | 474 | 8.0E-23 |
| sp|P29980|CPXN_NOSS1 | Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 | 136 | 468 | 9.0E-23 |
| sp|P51538|CP3A9_RAT | Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 | 147 | 474 | 3.0E-22 |
| sp|Q8SPK1|CP4AO_PIG | Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 | 294 | 474 | 5.0E-22 |
| sp|Q8SPK0|CP4AP_PIG | Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 | 294 | 474 | 8.0E-22 |
| sp|Q98T91|C340_ORYLA | Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 | 104 | 469 | 9.0E-22 |
| sp|Q02928|CP4AB_HUMAN | Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 | 294 | 474 | 2.0E-21 |
| sp|O42563|CP3AR_ONCMY | Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 | 303 | 474 | 2.0E-21 |
| sp|Q54CS3|C508C_DICDI | Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508C1 PE=3 SV=1 | 216 | 509 | 2.0E-21 |
| sp|O15528|CP27B_HUMAN | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 | 269 | 474 | 4.0E-21 |
| sp|P79152|CP3AJ_CAPHE | Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 | 309 | 474 | 7.0E-21 |
| sp|Q12612|TRI4_FUSSP | Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 | 92 | 474 | 8.0E-21 |
| sp|O35132|CP27B_RAT | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 | 191 | 474 | 8.0E-21 |
| sp|Q1ZXA4|C508D_DICDI | Probable cytochrome P450 508D1 OS=Dictyostelium discoideum GN=cyp508D1 PE=3 SV=1 | 317 | 508 | 1.0E-20 |
| sp|O88833|CP4AA_MOUSE | Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 | 298 | 474 | 3.0E-20 |
| sp|P98187|CP4F8_HUMAN | Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 | 92 | 478 | 3.0E-20 |
| sp|O00061|CP67_UROFA | Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 | 92 | 474 | 4.0E-20 |
| sp|Q9GJX5|CP4AL_PIG | Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 | 169 | 474 | 4.0E-20 |
| sp|O35728|CP4AE_MOUSE | Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 | 298 | 474 | 5.0E-20 |
| sp|Q9LHA1|C8D11_ARATH | Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 | 314 | 479 | 7.0E-20 |
| sp|P51590|CP2J3_RAT | Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 | 163 | 463 | 7.0E-20 |
| sp|Q9V4U9|C6A13_DROME | Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 | 300 | 478 | 1.0E-19 |
| sp|O16805|CP4D1_DROSI | Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 | 106 | 468 | 1.0E-19 |
| sp|O35084|CP27B_MOUSE | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 | 191 | 474 | 1.0E-19 |
| sp|B9DFU2|MAX1_ARATH | Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 | 300 | 471 | 1.0E-19 |
| sp|P14579|CP4A5_RABIT | Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 | 296 | 474 | 1.0E-19 |
| sp|P08516|CP4AA_RAT | Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 | 294 | 474 | 1.0E-19 |
| sp|Q9V770|C6A17_DROME | Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 | 261 | 462 | 2.0E-19 |
| sp|P37122|C76A2_SOLME | Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 | 56 | 474 | 2.0E-19 |
| sp|P20816|CP4A2_RAT | Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 | 296 | 474 | 2.0E-19 |
| sp|Q27518|C13A2_CAEEL | Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 | 147 | 465 | 2.0E-19 |
| sp|O46051|C4D14_DROME | Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 | 105 | 474 | 2.0E-19 |
| sp|P33269|CP4D1_DROME | Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 | 106 | 468 | 2.0E-19 |
| sp|Q54F47|C513C_DICDI | Probable cytochrome P450 513C1 OS=Dictyostelium discoideum GN=cyp513C1 PE=3 SV=1 | 146 | 474 | 2.0E-19 |
| sp|P20817|CP4AE_RAT | Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 | 296 | 474 | 2.0E-19 |
| sp|P36423|THAS_MOUSE | Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 | 304 | 494 | 3.0E-19 |
| sp|P14581|CP4A7_RABIT | Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 | 296 | 474 | 3.0E-19 |
| sp|Q5TCH4|CP4AM_HUMAN | Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 | 294 | 474 | 4.0E-19 |
| sp|Q8K4D6|CP4X1_RAT | Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 | 276 | 474 | 4.0E-19 |
| sp|P49430|THAS_RAT | Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 | 253 | 479 | 4.0E-19 |
| sp|Q91WL5|CP4CA_MOUSE | Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 | 298 | 474 | 4.0E-19 |
| sp|P56593|CP2AC_MOUSE | Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 | 81 | 463 | 5.0E-19 |
| sp|Q8AXY5|C356_FUNHE | Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 | 297 | 469 | 5.0E-19 |
| sp|Q9PVE8|C330_FUNHE | Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 | 297 | 469 | 5.0E-19 |
| sp|Q9Y6A2|CP46A_HUMAN | Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 | 92 | 471 | 7.0E-19 |
| sp|Q6A152|CP4X1_MOUSE | Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 | 260 | 474 | 7.0E-19 |
| sp|S4UX02|CYPH1_SALMI | Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 | 316 | 492 | 8.0E-19 |
| sp|P47787|THAS_PIG | Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 | 303 | 474 | 8.0E-19 |
| sp|Q948Y1|C719A_COPJA | (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 | 313 | 498 | 8.0E-19 |
| sp|Q0IIF9|CP2U1_BOVIN | Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 | 251 | 474 | 8.0E-19 |
| sp|P13527|CP6A1_MUSDO | Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 | 147 | 468 | 9.0E-19 |
| sp|Q9V771|C6A23_DROME | Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 | 303 | 462 | 1.0E-18 |
| sp|Q27520|C13A1_CAEEL | Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 | 147 | 474 | 1.0E-18 |
| sp|Q9VB31|C6A18_DROME | Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 | 303 | 474 | 1.0E-18 |
| sp|P14580|CP4A6_RABIT | Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 | 296 | 478 | 1.0E-18 |
| sp|Q27517|C13A3_CAEEL | Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 | 147 | 474 | 1.0E-18 |
| sp|P24464|CP4AC_RAT | Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 | 298 | 474 | 1.0E-18 |
| sp|Q9HCS2|CP4FC_HUMAN | Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 | 294 | 474 | 2.0E-18 |
| sp|Q9VLZ7|C4D21_DROME | Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 | 108 | 469 | 2.0E-18 |
| sp|P24455|CP2A9_MESAU | Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2 | 96 | 475 | 3.0E-18 |
| sp|P10611|CP4A4_RABIT | Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 | 296 | 474 | 3.0E-18 |
| sp|Q7KWN2|C525A_DICDI | Probable cytochrome P450 525A1 OS=Dictyostelium discoideum GN=cyp525A1 PE=3 SV=1 | 253 | 474 | 4.0E-18 |
| sp|P78329|CP4F2_HUMAN | Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 | 294 | 474 | 4.0E-18 |
| sp|Q9V773|C6A20_DROME | Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 | 264 | 488 | 4.0E-18 |
| sp|Q86W10|CP4Z1_HUMAN | Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 | 261 | 474 | 4.0E-18 |
| sp|Q9WVK8|CP46A_MOUSE | Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 | 92 | 471 | 5.0E-18 |
| sp|P52786|CP2J1_RABIT | Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 | 163 | 463 | 5.0E-18 |
| sp|Q9LTM0|C71BN_ARATH | Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 | 296 | 501 | 6.0E-18 |
| sp|Q9V6H1|CP9H1_DROME | Probable cytochrome P450 9h1 OS=Drosophila melanogaster GN=Cyp9h1 PE=3 SV=1 | 144 | 480 | 6.0E-18 |
| sp|Q4V8D1|CP2U1_RAT | Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 | 251 | 474 | 6.0E-18 |
| sp|Q7Z449|CP2U1_HUMAN | Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 | 251 | 474 | 7.0E-18 |
| sp|Q55AJ4|C516B_DICDI | Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 | 317 | 474 | 7.0E-18 |
| sp|Q9HBI6|CP4FB_HUMAN | Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 | 294 | 474 | 7.0E-18 |
| sp|P15128|CP4B1_RABIT | Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 | 102 | 474 | 7.0E-18 |
| sp|P51869|CP4F4_RAT | Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 | 294 | 474 | 7.0E-18 |
| sp|Q09653|C13AA_CAEEL | Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 | 147 | 474 | 8.0E-18 |
| sp|P33270|CP6A2_DROME | Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 | 303 | 474 | 8.0E-18 |
| sp|Q9DBW0|CP4V2_MOUSE | Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 | 144 | 474 | 9.0E-18 |
| sp|P51589|CP2J2_HUMAN | Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 | 316 | 463 | 9.0E-18 |
| sp|Q8N118|CP4X1_HUMAN | Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 | 122 | 474 | 1.0E-17 |
| sp|Q9V776|CP317_DROME | Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 | 295 | 458 | 1.0E-17 |
| sp|Q9VVN6|CP312_DROME | Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 | 105 | 474 | 1.0E-17 |
| sp|Q82IY3|PTLI_STRAW | Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 | 95 | 468 | 1.0E-17 |
| sp|A2RRT9|CP4V2_RAT | Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 | 147 | 468 | 1.0E-17 |
| sp|Q27519|C13A7_CAEEL | Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 | 147 | 465 | 1.0E-17 |
| sp|P51870|CP4F5_RAT | Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 | 294 | 474 | 1.0E-17 |
| sp|O46054|C4AE1_DROME | Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 | 272 | 469 | 1.0E-17 |
| sp|Q27516|C13A8_CAEEL | Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 | 147 | 464 | 1.0E-17 |
| sp|Q59990|CP120_SYNY3 | Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 | 251 | 474 | 2.0E-17 |
| sp|O55071|CP2BJ_MOUSE | Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 | 147 | 463 | 2.0E-17 |
| sp|O54750|CP2J6_MOUSE | Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 | 316 | 463 | 2.0E-17 |
| sp|P11711|CP2A1_RAT | Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 | 107 | 463 | 2.0E-17 |
| sp|Q55BU9|C5133_DICDI | Probable cytochrome P450 513A3 OS=Dictyostelium discoideum GN=cyp513A3 PE=3 SV=1 | 240 | 463 | 2.0E-17 |
| sp|Q9VXY0|CP4S3_DROME | Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 | 294 | 474 | 2.0E-17 |
| sp|Q27514|C13A5_CAEEL | Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 | 104 | 465 | 2.0E-17 |
| sp|Q27593|CP6A8_DROME | Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 | 126 | 468 | 3.0E-17 |
| sp|O64638|C76C3_ARATH | Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 | 298 | 474 | 3.0E-17 |
| sp|P24460|CP2BB_CANLF | Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 | 147 | 463 | 3.0E-17 |
| sp|Q43068|C82A1_PEA | Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 | 317 | 474 | 4.0E-17 |
| sp|Q95036|CP6B5_PAPGL | Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 | 302 | 474 | 4.0E-17 |
| sp|O23051|KAO1_ARATH | Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 | 298 | 478 | 4.0E-17 |
| sp|Q27902|CP6B4_PAPGL | Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 | 302 | 474 | 5.0E-17 |
| sp|Q6VVX0|CP2R1_HUMAN | Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 | 317 | 499 | 5.0E-17 |
| sp|Q6ZWL3|CP4V2_HUMAN | Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 | 92 | 462 | 6.0E-17 |
| sp|P24557|THAS_HUMAN | Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 | 303 | 494 | 6.0E-17 |
| sp|Q2PG45|THAS_MACFA | Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 | 303 | 494 | 6.0E-17 |
| sp|O48923|C71DA_SOYBN | Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 | 295 | 507 | 6.0E-17 |
| sp|O65790|C81F1_ARATH | Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 | 316 | 474 | 7.0E-17 |
| sp|Q2KIG5|THAS_BOVIN | Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 | 303 | 456 | 7.0E-17 |
| sp|Q6WNQ8|C81E8_MEDTR | Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 | 294 | 459 | 7.0E-17 |
| sp|Q69X58|C76M7_ORYSJ | Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 | 252 | 459 | 8.0E-17 |
| sp|P00179|CP2C5_RABIT | Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 | 131 | 507 | 8.0E-17 |
| sp|Q9SD85|F3PH_ARATH | Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 | 299 | 474 | 9.0E-17 |
| sp|P15129|CP4B1_RAT | Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 | 302 | 474 | 9.0E-17 |
| sp|Q9SBQ9|F3PH_PETHY | Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 | 298 | 474 | 1.0E-16 |
| sp|P51871|CP4F6_RAT | Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 | 303 | 474 | 1.0E-16 |
| sp|P17178|CP27A_RAT | Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 | 317 | 474 | 1.0E-16 |
| sp|Q9VS79|CP4D8_DROME | Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 | 150 | 470 | 1.0E-16 |
| sp|Q1ZXL7|C5083_DICDI | Probable cytochrome P450 508A3 OS=Dictyostelium discoideum GN=cyp508A3-1 PE=3 SV=1 | 316 | 489 | 1.0E-16 |
| sp|Q9W011|C4D20_DROME | Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 | 162 | 475 | 1.0E-16 |
| sp|O48786|C734A_ARATH | Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 | 160 | 468 | 1.0E-16 |
| sp|B1NF19|C719D_ARGME | (S)-stylopine synthase OS=Argemone mexicana GN=CYP719A13 PE=1 SV=1 | 316 | 498 | 1.0E-16 |
| sp|Q6R7M4|C15A1_DIPPU | Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 | 316 | 484 | 2.0E-16 |
| sp|Q964R1|CP6J1_BLAGE | Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 | 296 | 466 | 2.0E-16 |
| sp|Q5RCN6|CP4V2_PONAB | Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 | 92 | 462 | 2.0E-16 |
| sp|Q9CX98|CP2U1_MOUSE | Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 | 251 | 463 | 2.0E-16 |
| sp|Q9FG65|C81D1_ARATH | Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 | 245 | 483 | 2.0E-16 |
| sp|P33265|CP2CS_MESAU | Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 | 147 | 463 | 2.0E-16 |
| sp|Q9LTL2|C71BP_ARATH | Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 | 296 | 492 | 2.0E-16 |
| sp|Q08477|CP4F3_HUMAN | Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 | 294 | 474 | 2.0E-16 |
| sp|Q9VMS8|C4AC2_DROME | Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 | 249 | 489 | 2.0E-16 |
| sp|Q9XHE8|C71DI_MENSP | Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 | 288 | 490 | 2.0E-16 |
| sp|Q6WKZ1|C71DI_MENGR | Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 | 288 | 490 | 2.0E-16 |
| sp|Q27589|CP4D2_DROME | Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 | 276 | 474 | 2.0E-16 |
| sp|P20812|CP2A3_RAT | Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 | 92 | 463 | 2.0E-16 |
| sp|Q42716|C71A8_MENPI | Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 | 316 | 474 | 2.0E-16 |
| sp|Q9DBG1|CP27A_MOUSE | Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 | 316 | 474 | 2.0E-16 |
| sp|Q9EP75|CP4FE_MOUSE | Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 | 294 | 474 | 2.0E-16 |
| sp|O64635|C76C4_ARATH | Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 | 187 | 492 | 3.0E-16 |
| sp|P58049|C71BB_ARATH | Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 | 318 | 501 | 3.0E-16 |
| sp|O54749|CP2J5_MOUSE | Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 | 150 | 463 | 3.0E-16 |
| sp|Q92090|CP2K1_ONCMY | Cytochrome P450 2K1 OS=Oncorhynchus mykiss GN=cyp2k1 PE=2 SV=1 | 316 | 490 | 4.0E-16 |
| sp|P48522|TCMO_CATRO | Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1 | 129 | 474 | 4.0E-16 |
| sp|P11509|CP2A6_HUMAN | Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 | 124 | 463 | 4.0E-16 |
| sp|O48922|C98A2_SOYBN | Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 | 209 | 493 | 4.0E-16 |
| sp|Q9SZ46|C82C4_ARATH | Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 | 317 | 474 | 4.0E-16 |
| sp|Q9VYQ7|CP311_DROME | Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 | 276 | 474 | 4.0E-16 |
| sp|P12790|CP2B9_MOUSE | Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 | 147 | 463 | 4.0E-16 |
| sp|Q6WKZ0|C7D94_MENGR | Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 | 288 | 490 | 4.0E-16 |
| sp|P13584|CP4B1_HUMAN | Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 | 298 | 474 | 4.0E-16 |
| sp|Q27513|C13A4_CAEEL | Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 | 104 | 465 | 4.0E-16 |
| sp|Q9VL92|CP4E3_DROME | Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 | 100 | 489 | 4.0E-16 |
| sp|P93147|C81E1_GLYEC | Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 | 136 | 474 | 5.0E-16 |
| sp|Q9V4U7|C6A14_DROME | Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 | 303 | 474 | 5.0E-16 |
| sp|Q43240|TCMO_ZINVI | Trans-cinnamate 4-monooxygenase OS=Zinnia violacea GN=CYP73A12 PE=2 SV=1 | 272 | 474 | 5.0E-16 |
| sp|P00182|CP2C3_RABIT | Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 | 316 | 463 | 5.0E-16 |
| sp|Q947B7|MFS_MENPI | (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 | 276 | 498 | 6.0E-16 |
| sp|Q949P1|ABAH1_ARATH | Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 | 251 | 465 | 7.0E-16 |
| sp|Q99N16|CP4F3_MOUSE | Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 | 294 | 474 | 8.0E-16 |
| sp|Q9V9L1|CP6W1_DROME | Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 | 311 | 466 | 9.0E-16 |
| sp|O64636|C76C1_ARATH | Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 | 299 | 474 | 9.0E-16 |
| sp|Q1ZXG6|C5131_DICDI | Probable cytochrome P450 513A1 OS=Dictyostelium discoideum GN=cyp513A1 PE=3 SV=1 | 276 | 463 | 9.0E-16 |
| sp|P20853|CP2A7_HUMAN | Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 | 124 | 463 | 1.0E-15 |
| sp|Q1ZXF5|C5084_DICDI | Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 | 315 | 489 | 1.0E-15 |
| sp|O17624|C13B1_CAEEL | Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 | 290 | 471 | 1.0E-15 |
| sp|Q05556|CP2AB_RABIT | Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 | 92 | 463 | 1.0E-15 |
| sp|Q9Y757|CP52L_DEBHN | Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 | 188 | 476 | 1.0E-15 |
| sp|O08336|CYPB_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 | 260 | 465 | 1.0E-15 |
| sp|Q04468|TCMO_HELTU | Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1 | 293 | 474 | 1.0E-15 |
| sp|Q9VYY4|C4G15_DROME | Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 | 294 | 465 | 1.0E-15 |
| sp|Q6YV88|C71Z7_ORYSJ | Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 | 316 | 499 | 1.0E-15 |
| sp|P58050|C71BD_ARATH | Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 | 316 | 501 | 1.0E-15 |
| sp|P13107|CP2B3_RAT | Cytochrome P450 2B3 OS=Rattus norvegicus GN=Cyp2b3 PE=2 SV=1 | 107 | 463 | 1.0E-15 |
| sp|Q9GQM9|CP6L1_BLAGE | Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 | 147 | 466 | 1.0E-15 |
| sp|Q02318|CP27A_HUMAN | Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 | 150 | 474 | 1.0E-15 |
| sp|O24312|TCMO_POPTM | Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1 | 272 | 474 | 1.0E-15 |
| sp|O46515|CP11A_HORSE | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 | 92 | 465 | 2.0E-15 |
| sp|Q6YTF1|C76M8_ORYSJ | Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 | 252 | 459 | 2.0E-15 |
| sp|Q9VW43|CP305_DROME | Probable cytochrome P450 305a1 OS=Drosophila melanogaster GN=Cyp305a1 PE=2 SV=1 | 277 | 461 | 2.0E-15 |
| sp|P20813|CP2B6_HUMAN | Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1 SV=1 | 149 | 463 | 2.0E-15 |
| sp|Q9AXH9|KAO1_HORVU | Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1 | 146 | 482 | 2.0E-15 |
| sp|P24454|CP2A8_MESAU | Cytochrome P450 2A8 OS=Mesocricetus auratus GN=CYP2A8 PE=1 SV=1 | 124 | 463 | 2.0E-15 |
| sp|Q3MID2|CP4F3_RAT | Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 | 303 | 474 | 2.0E-15 |
| sp|P20852|CP2A5_MOUSE | Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 | 92 | 463 | 2.0E-15 |
| sp|Q43246|C88A1_MAIZE | Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 | 146 | 480 | 2.0E-15 |
| sp|Q9V3S0|CP4G1_DROME | Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 | 302 | 465 | 3.0E-15 |
| sp|Q64462|CP4B1_MOUSE | Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 | 302 | 474 | 3.0E-15 |
| sp|P20678|CP2H2_CHICK | Cytochrome P450 2H2 OS=Gallus gallus GN=CYP2H2 PE=1 SV=1 | 107 | 463 | 3.0E-15 |
| sp|P15123|CP2CG_RABIT | Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 | 128 | 507 | 3.0E-15 |
| sp|Q9VQD2|CP391_DROME | Probable cytochrome P450 309a1 OS=Drosophila melanogaster GN=Cyp309a1 PE=1 SV=4 | 147 | 491 | 3.0E-15 |
| sp|B5UAQ8|C7195_ESCCA | Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 | 260 | 474 | 3.0E-15 |
| sp|Q43054|TCMO_POPKI | Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1 | 272 | 474 | 3.0E-15 |
| sp|Q27594|CP6A9_DROME | Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 | 264 | 468 | 3.0E-15 |
| sp|Q54SK0|C508B_DICDI | Probable cytochrome P450 508B1 OS=Dictyostelium discoideum GN=cyp508B1 PE=3 SV=1 | 298 | 474 | 4.0E-15 |
| sp|D5JBX0|GAO_HELAN | Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 | 288 | 474 | 4.0E-15 |
| sp|Q54SN0|C513E_DICDI | Probable cytochrome P450 513E1 OS=Dictyostelium discoideum GN=cyp513E1 PE=3 SV=1 | 289 | 468 | 4.0E-15 |
| sp|Q27515|C13A6_CAEEL | Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 | 301 | 474 | 4.0E-15 |
| sp|Q9SAE4|C71BT_ARATH | Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=3 SV=1 | 293 | 474 | 4.0E-15 |
| sp|P17666|CP2CE_RABIT | Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1 | 316 | 463 | 4.0E-15 |
| sp|F4JW83|C84A4_ARATH | Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 | 318 | 474 | 4.0E-15 |
| sp|Q9V674|CP6G1_DROME | Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 | 311 | 466 | 4.0E-15 |
| sp|A6YIH8|C7D55_HYOMU | Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 | 316 | 474 | 4.0E-15 |
| sp|P11371|CP2C4_RABIT | Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 | 131 | 507 | 4.0E-15 |
| sp|P58051|C71BE_ARATH | Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 | 302 | 501 | 4.0E-15 |
| sp|P24461|CP2G1_RABIT | Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 | 147 | 463 | 5.0E-15 |
| sp|C0SJS3|ANGS_PASSA | Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 | 316 | 490 | 5.0E-15 |
| sp|Q556M5|C5081_DICDI | Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 | 315 | 492 | 5.0E-15 |
| sp|Q50LH4|C7193_ESCCA | (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 | 285 | 488 | 6.0E-15 |
| sp|O49858|C82A3_SOYBN | Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 | 170 | 474 | 6.0E-15 |
| sp|Q9V419|C28A5_DROME | Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 | 239 | 474 | 6.0E-15 |
| sp|O65788|C71B2_ARATH | Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 | 100 | 492 | 7.0E-15 |
| sp|Q9VG82|CP9F2_DROME | Probable cytochrome P450 9f2 OS=Drosophila melanogaster GN=Cyp9f2 PE=2 SV=1 | 147 | 480 | 7.0E-15 |
| sp|P9WPP9|CP51_MYCTU | Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp51 PE=1 SV=1 | 304 | 464 | 7.0E-15 |
| sp|P9WPP8|CP51_MYCTO | Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp51 PE=3 SV=1 | 304 | 464 | 7.0E-15 |
| sp|P0A513|CP51_MYCBO | Lanosterol 14-alpha demethylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp51 PE=3 SV=1 | 304 | 464 | 7.0E-15 |
| sp|Q9LTL8|C71BO_ARATH | Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 | 299 | 474 | 7.0E-15 |
| sp|P10632|CP2C8_HUMAN | Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 | 316 | 507 | 7.0E-15 |
| sp|P08686|CP21A_HUMAN | Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 | 316 | 474 | 8.0E-15 |
| sp|Q9AR74|TCMO_RUTGR | Trans-cinnamate 4-monooxygenase OS=Ruta graveolens GN=CYP73A2 PE=2 SV=1 | 264 | 474 | 8.0E-15 |
| sp|Q9K498|EIZFM_STRCO | Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 | 251 | 487 | 9.0E-15 |
| sp|Q9ZU07|C71BC_ARATH | Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 | 318 | 501 | 9.0E-15 |
| sp|D4AY62|A1131_ARTBC | Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 | 102 | 474 | 9.0E-15 |
| sp|P00178|CP2B4_RABIT | Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 | 147 | 463 | 9.0E-15 |
| sp|Q6WNR0|C81E7_MEDTR | Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 | 316 | 499 | 9.0E-15 |
| sp|Q64441|CP24A_MOUSE | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 | 293 | 466 | 1.0E-14 |
| sp|D5JBW8|GAO_CICIN | Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 | 288 | 474 | 1.0E-14 |
| sp|P92994|TCMO_ARATH | Trans-cinnamate 4-monooxygenase OS=Arabidopsis thaliana GN=CYP73A5 PE=2 SV=1 | 293 | 474 | 1.0E-14 |
| sp|Q9QYG6|CP2DR_MESAU | Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 | 244 | 463 | 1.0E-14 |
| sp|P03940|CP21A_MOUSE | Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 | 177 | 483 | 1.0E-14 |
| sp|Q9VMS9|C4AC1_DROME | Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 | 294 | 489 | 1.0E-14 |
| sp|Q12587|CP52Q_CANMA | Cytochrome P450 52C2 OS=Candida maltosa GN=CYP52C2 PE=2 SV=1 | 177 | 483 | 1.0E-14 |
| sp|P08682|CP2E1_RABIT | Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 | 316 | 463 | 2.0E-14 |
| sp|P33274|CP4F1_RAT | Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 | 294 | 474 | 2.0E-14 |
| sp|O18596|C4D10_DROMT | Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 | 273 | 468 | 2.0E-14 |
| sp|Q6VVW9|CP2R1_MOUSE | Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 | 317 | 499 | 2.0E-14 |
| sp|Q9W223|CP6D2_DROME | Probable cytochrome P450 6d2 OS=Drosophila melanogaster GN=Cyp6d2 PE=2 SV=1 | 293 | 474 | 2.0E-14 |
| sp|Q12588|CP52J_CANMA | Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 | 308 | 480 | 2.0E-14 |
| sp|Q0DBF4|C7018_ORYSJ | Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 | 221 | 490 | 2.0E-14 |
| sp|O49396|C82C3_ARATH | Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 | 316 | 474 | 2.0E-14 |
| sp|Q964R0|CP6K1_BLAGE | Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 | 302 | 474 | 2.0E-14 |
| sp|P10615|CP52A_CANTR | Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 | 257 | 478 | 2.0E-14 |
| sp|Q9DBX6|CP2S1_MOUSE | Cytochrome P450 2S1 OS=Mus musculus GN=Cyp2s1 PE=1 SV=1 | 235 | 474 | 2.0E-14 |
| sp|Q96SQ9|CP2S1_HUMAN | Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 | 316 | 474 | 2.0E-14 |
| sp|P00181|CP2C2_RABIT | Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 | 296 | 463 | 2.0E-14 |
| sp|P79402|CP242_PIG | Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 | 261 | 463 | 2.0E-14 |
| sp|P93531|C71D7_SOLCH | Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 | 272 | 507 | 2.0E-14 |
| sp|P82711|C6A19_DROME | Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 | 147 | 474 | 3.0E-14 |
| sp|Q964T2|CP9E2_BLAGE | Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 | 311 | 474 | 3.0E-14 |
| sp|P15540|CP21A_PIG | Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 | 177 | 483 | 3.0E-14 |
| sp|H2DH22|C7A10_PANGI | Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 | 276 | 493 | 3.0E-14 |
| sp|P15392|CP2A4_MOUSE | Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 | 104 | 463 | 3.0E-14 |
| sp|P58048|C71B8_ARATH | Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 | 317 | 501 | 3.0E-14 |
| sp|O49859|C82A4_SOYBN | Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 | 256 | 474 | 3.0E-14 |
| sp|Q07973|CP24A_HUMAN | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 | 300 | 466 | 3.0E-14 |
| sp|Q556M4|C5082_DICDI | Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 | 315 | 508 | 3.0E-14 |
| sp|Q7X7X4|C99A2_ORYSJ | Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 | 316 | 490 | 3.0E-14 |
| sp|Q94FM7|C71DK_TOBAC | 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 | 316 | 502 | 3.0E-14 |
| sp|Q9LTM4|C71BJ_ARATH | Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 | 177 | 490 | 3.0E-14 |
| sp|P00176|CP2B1_RAT | Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 | 127 | 463 | 3.0E-14 |
| sp|Q9VRB3|CP6V1_DROME | Probable cytochrome P450 6v1 OS=Drosophila melanogaster GN=Cyp6v1 PE=2 SV=1 | 169 | 471 | 3.0E-14 |
| sp|Q9CA60|C98A9_ARATH | Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 | 277 | 474 | 4.0E-14 |
| sp|Q9SAE3|C71BS_ARATH | Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 | 316 | 474 | 4.0E-14 |
| sp|Q9FH76|ABAH3_ARATH | Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 | 251 | 463 | 4.0E-14 |
| sp|P08683|CP2CB_RAT | Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 | 163 | 463 | 4.0E-14 |
| sp|Q5IZM4|CP51_MYCVP | Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 | 304 | 464 | 4.0E-14 |
| sp|O93297|CP2K4_ONCMY | Cytochrome P450 2K4 OS=Oncorhynchus mykiss GN=cyp2k4 PE=2 SV=1 | 362 | 490 | 4.0E-14 |
| sp|Q8WNE1|CP2F5_GORGO | Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 | 316 | 463 | 4.0E-14 |
| sp|Q43255|C71C2_MAIZE | indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 | 316 | 474 | 4.0E-14 |
| sp|Q96514|C71B7_ARATH | Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 | 290 | 501 | 4.0E-14 |
| sp|Q9CAD6|C86A7_ARATH | Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 | 84 | 472 | 4.0E-14 |
| sp|Q9QYG5|CP2DK_MESAU | Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 | 244 | 463 | 4.0E-14 |
| sp|Q9V7G5|C4AA1_DROME | Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 | 257 | 474 | 4.0E-14 |
| sp|Q9LSF8|C82G1_ARATH | Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 | 317 | 480 | 4.0E-14 |
| sp|D5JBW9|GAO_SAUCO | Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 | 288 | 474 | 4.0E-14 |
| sp|O65787|C71B6_ARATH | Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 | 255 | 474 | 4.0E-14 |
| sp|Q12589|CP52K_CANMA | Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 | 191 | 480 | 4.0E-14 |
| sp|Q9VCW1|CP6D4_DROME | Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 | 303 | 494 | 5.0E-14 |
| sp|Q2LA59|CP21A_LYNLY | Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 | 151 | 474 | 5.0E-14 |
| sp|Q16696|CP2AD_HUMAN | Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 | 244 | 463 | 5.0E-14 |
| sp|O65438|C71AR_ARATH | Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 | 316 | 474 | 5.0E-14 |
| sp|O49394|C82C2_ARATH | Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 | 317 | 474 | 5.0E-14 |
| sp|B5BSX1|BAMO_GLYUR | Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 | 146 | 482 | 5.0E-14 |
| sp|Q9VGH1|CP315_DROME | Cytochrome P450 315a1, mitochondrial OS=Drosophila melanogaster GN=sad PE=2 SV=1 | 169 | 490 | 5.0E-14 |
| sp|Q05555|CP2AA_RABIT | Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 | 92 | 463 | 5.0E-14 |
| sp|Q43033|TCMO_PETCR | Trans-cinnamate 4-monooxygenase OS=Petroselinum crispum GN=CYP73A10 PE=2 SV=1 | 293 | 474 | 5.0E-14 |
| sp|Q9LTM6|C71BH_ARATH | Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 | 177 | 461 | 5.0E-14 |
| sp|P12789|CP2B5_RABIT | Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1 | 124 | 463 | 5.0E-14 |
| sp|Q50LH3|C7192_ESCCA | (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 | 322 | 487 | 6.0E-14 |
| sp|P05180|CP2H1_CHICK | Cytochrome P450 2H1 OS=Gallus gallus GN=CYP2H1 PE=2 SV=1 | 147 | 463 | 6.0E-14 |
| sp|Q29510|CP2CU_RABIT | Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 | 316 | 463 | 6.0E-14 |
| sp|P16141|CP52D_CANMA | Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 | 182 | 474 | 6.0E-14 |
| sp|P17177|CP27A_RABIT | Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 | 301 | 470 | 6.0E-14 |
| sp|Q92104|CP11B_LITCT | Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 | 316 | 501 | 6.0E-14 |
| sp|Q9D816|CP255_MOUSE | Cytochrome P450 2C55 OS=Mus musculus GN=Cyp2c55 PE=1 SV=1 | 124 | 463 | 6.0E-14 |
| sp|B1NF20|C719E_ARGME | Cheilanthifoline synthase OS=Argemone mexicana GN=CYP719A14 PE=1 SV=1 | 260 | 498 | 6.0E-14 |
| sp|P33272|CP2BC_RAT | Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 | 261 | 463 | 6.0E-14 |
| sp|B1NF18|C719B_PAPSO | Salutaridine synthase OS=Papaver somniferum GN=CYP719B1 PE=1 SV=1 | 316 | 474 | 6.0E-14 |
| sp|P79153|CP11A_CAPHI | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 | 178 | 465 | 6.0E-14 |
| sp|P56656|CP239_MOUSE | Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 | 261 | 507 | 6.0E-14 |
| sp|P49264|C71B1_THLAR | Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 | 318 | 515 | 7.0E-14 |
| sp|Q2LA60|CP21A_FELCA | Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 | 177 | 474 | 7.0E-14 |
| sp|Q9LIP6|C71BV_ARATH | Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 | 301 | 490 | 7.0E-14 |
| sp|P29981|CP4C1_BLADI | Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 | 294 | 502 | 7.0E-14 |
| sp|P04167|CP2B2_RAT | Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 | 127 | 463 | 7.0E-14 |
| sp|O64637|C76C2_ARATH | Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 | 299 | 492 | 7.0E-14 |
| sp|Q9W130|CP9C1_DROME | Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 | 298 | 464 | 7.0E-14 |
| sp|P33273|CP255_RAT | Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 | 163 | 463 | 7.0E-14 |
| sp|C0SPF7|C15C1_BOMMO | Farnesoate epoxidase OS=Bombyx mori GN=CYP15C1 PE=1 SV=2 | 256 | 474 | 8.0E-14 |
| sp|C0SJS4|C71AJ_APIGR | Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 | 318 | 490 | 8.0E-14 |
| sp|P33262|CP2CK_MACFA | Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 | 316 | 507 | 9.0E-14 |
| sp|P00189|CP11A_BOVIN | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus GN=CYP11A1 PE=1 SV=1 | 178 | 465 | 9.0E-14 |
| sp|Q42600|C84A1_ARATH | Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 | 318 | 504 | 9.0E-14 |
| sp|Q6NT55|CP4FN_HUMAN | Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 | 294 | 474 | 9.0E-14 |
| sp|P37124|C77A2_SOLME | Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 | 136 | 474 | 9.0E-14 |
| sp|P33263|CP2CQ_MESAU | Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 | 298 | 507 | 9.0E-14 |
| sp|Q27664|CP6B2_HELAM | Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 | 301 | 502 | 9.0E-14 |
| sp|D5J9U8|GAO_LACSA | Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 | 288 | 474 | 1.0E-13 |
| sp|P9WPM1|CP139_MYCTU | Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 | 297 | 470 | 1.0E-13 |
| sp|P9WPM0|CP139_MYCTO | Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 | 297 | 470 | 1.0E-13 |
| sp|P63720|CP139_MYCBO | Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 | 297 | 470 | 1.0E-13 |
| sp|Q27712|CP2L1_PANAR | Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 | 265 | 463 | 1.0E-13 |
| sp|O65786|C71B4_ARATH | Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 | 318 | 474 | 1.0E-13 |
| sp|O18635|C12A2_MUSDO | Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 | 161 | 474 | 1.0E-13 |
| sp|O81928|TCMO_CICAR | Trans-cinnamate 4-monooxygenase OS=Cicer arietinum GN=CYP73A19 PE=2 SV=2 | 272 | 474 | 1.0E-13 |
| sp|Q9C5Y2|KAO2_ARATH | Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 | 293 | 474 | 1.0E-13 |
| sp|Q9V774|C6A21_DROME | Probable cytochrome P450 6a21 OS=Drosophila melanogaster GN=Cyp6a21 PE=2 SV=1 | 200 | 483 | 1.0E-13 |
| sp|Q964T1|CP4CU_BLAGE | Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 | 177 | 468 | 1.0E-13 |
| sp|Q9EPT4|CP11A_MESAU | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mesocricetus auratus GN=CYP11A1 PE=2 SV=1 | 179 | 501 | 1.0E-13 |
| sp|P30608|CP52F_CANTR | Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 | 317 | 474 | 1.0E-13 |
| sp|Q9V4T5|CP4E1_DROME | Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 | 100 | 474 | 2.0E-13 |
| sp|Q6Z5I7|C76M6_ORYSJ | Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 | 316 | 499 | 2.0E-13 |
| sp|P56654|CP237_MOUSE | Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 | 316 | 463 | 2.0E-13 |
| sp|Q92088|CP2M1_ONCMY | Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 | 316 | 463 | 2.0E-13 |
| sp|Q1ZXI7|C513F_DICDI | Probable cytochrome P450 513F1 OS=Dictyostelium discoideum GN=cyp513F1 PE=3 SV=1 | 317 | 469 | 2.0E-13 |
| sp|P30612|CP52P_CANTR | Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 | 294 | 474 | 2.0E-13 |
| sp|Q9V979|CP6U1_DROME | Probable cytochrome P450 6u1 OS=Drosophila melanogaster GN=Cyp6u1 PE=2 SV=3 | 287 | 463 | 2.0E-13 |
| sp|Q93VK5|LUT5_ARATH | Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 | 301 | 474 | 2.0E-13 |
| sp|A3A871|C71Z6_ORYSJ | Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 | 316 | 499 | 2.0E-13 |
| sp|P33264|CP2CR_MESAU | Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 | 131 | 463 | 2.0E-13 |
| sp|P11712|CP2C9_HUMAN | Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 | 163 | 463 | 2.0E-13 |
| sp|Q6YTF5|C76M5_ORYSJ | Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 | 316 | 499 | 2.0E-13 |
| sp|P33260|CP2CI_HUMAN | Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 | 124 | 463 | 2.0E-13 |
| sp|Q9VMS7|C4AC3_DROME | Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 | 294 | 489 | 2.0E-13 |
| sp|O04164|C71A6_NEPRA | Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 | 294 | 498 | 2.0E-13 |
| sp|Q05047|C72A1_CATRO | Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 | 102 | 474 | 2.0E-13 |
| sp|P00191|CP21A_BOVIN | Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 | 77 | 474 | 2.0E-13 |
| sp|P00180|CP2C1_RABIT | Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 | 316 | 463 | 2.0E-13 |
| sp|C0SJS2|C71AJ_PASSA | Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 | 318 | 478 | 2.0E-13 |
| sp|Q12581|CP52X_CANMA | Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 | 308 | 474 | 3.0E-13 |
| sp|P24903|CP2F1_HUMAN | Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 | 316 | 463 | 3.0E-13 |
| sp|Q09128|CP24A_RAT | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 | 293 | 466 | 3.0E-13 |
| sp|P9WPN2|CP132_MYCTO | Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 | 203 | 468 | 3.0E-13 |
| sp|P59954|CP132_MYCBO | Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 | 203 | 468 | 3.0E-13 |
| sp|P9WPN3|CP132_MYCTU | Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 | 203 | 468 | 3.0E-13 |
| sp|Q8VWZ7|C76B6_CATRO | Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 | 316 | 474 | 3.0E-13 |
| sp|Q9FI39|THAD_ARATH | Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 | 316 | 459 | 3.0E-13 |
| sp|Q9VGB5|CP135_DROME | Probable cytochrome P450 313a5 OS=Drosophila melanogaster GN=Cyp313a5 PE=1 SV=2 | 105 | 469 | 3.0E-13 |
| sp|Q43067|TCMO_PEA | Trans-cinnamate 4-monooxygenase OS=Pisum sativum GN=CYP73A9 PE=2 SV=2 | 272 | 474 | 3.0E-13 |
| sp|Q54NY3|C554A_DICDI | Probable cytochrome P450 554A1 OS=Dictyostelium discoideum GN=cyp554A1 PE=3 SV=1 | 298 | 474 | 3.0E-13 |
| sp|Q6QNI4|C71AJ_AMMMJ | Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 | 318 | 478 | 3.0E-13 |
| sp|P79202|CP11A_SHEEP | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 | 178 | 465 | 3.0E-13 |
| sp|B9X287|C7346_ORYSJ | Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 | 191 | 468 | 3.0E-13 |
| sp|P56655|CP238_MOUSE | Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 | 316 | 507 | 4.0E-13 |
| sp|Q91X77|CY250_MOUSE | Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 | 316 | 463 | 4.0E-13 |
| sp|Q9LTM7|C71BG_ARATH | Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 | 177 | 490 | 4.0E-13 |
| sp|O61387|CP6B7_HELAM | Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 | 302 | 474 | 4.0E-13 |
| sp|Q9LTM3|C71BK_ARATH | Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 | 177 | 490 | 4.0E-13 |
| sp|P30607|CP52B_CANTR | Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 | 317 | 474 | 4.0E-13 |
| sp|Q29478|CP2CV_CAPHE | Cytochrome P450 2C31 (Fragment) OS=Capra hircus aegagrus GN=CYP2C31 PE=2 SV=1 | 261 | 463 | 4.0E-13 |
| sp|Q9Y758|CP52M_DEBHN | Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 | 317 | 474 | 5.0E-13 |
| sp|Q9PUB4|CP26A_CHICK | Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 PE=2 SV=1 | 302 | 470 | 5.0E-13 |
| sp|O35293|CP2F2_RAT | Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 | 316 | 463 | 5.0E-13 |
| sp|P51581|CP2E1_MESAU | Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 | 312 | 507 | 5.0E-13 |
| sp|P48416|CP10_LYMST | Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 | 299 | 474 | 5.0E-13 |
| sp|O81970|C71A9_SOYBN | Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 | 316 | 492 | 5.0E-13 |
| sp|Q42797|TCMO_SOYBN | Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1 | 293 | 474 | 5.0E-13 |
| sp|P82712|CCD1P_DROME | Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 | 316 | 500 | 5.0E-13 |
| sp|Q12586|CP52I_CANMA | Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 | 191 | 480 | 5.0E-13 |
| sp|P12791|CP2BA_MOUSE | Cytochrome P450 2B10 OS=Mus musculus GN=Cyp2b10 PE=1 SV=1 | 147 | 463 | 6.0E-13 |
| sp|P56594|CP2CL_CANLF | Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 | 316 | 474 | 6.0E-13 |
| sp|Q96581|C75A4_GENTR | Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 | 316 | 501 | 6.0E-13 |
| sp|Q9XHE6|C71DF_MENPI | Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 | 288 | 492 | 6.0E-13 |
| sp|Q96423|TCMO_GLYEC | Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1 | 293 | 474 | 6.0E-13 |
| sp|Q2LCM1|CP21A_CANLU | Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 | 316 | 474 | 7.0E-13 |
| sp|Q8WNW0|CP21A_CANLF | Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 | 316 | 474 | 7.0E-13 |
| sp|Q43078|C97B1_PEA | Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 | 307 | 466 | 7.0E-13 |
| sp|Q9QZ82|CP11A_MOUSE | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 | 294 | 502 | 7.0E-13 |
| sp|Q9VFP1|CP6D5_DROME | Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 | 147 | 474 | 7.0E-13 |
| sp|Q93Z79|C14A1_ARATH | Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 | 298 | 468 | 8.0E-13 |
| sp|Q9LIP3|C71BY_ARATH | Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 | 302 | 501 | 8.0E-13 |
| sp|P33267|CP2F2_MOUSE | Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 | 317 | 463 | 8.0E-13 |
| sp|O48956|C98A1_SORBI | Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 | 318 | 477 | 9.0E-13 |
| sp|P37115|TCMO_VIGRR | Trans-cinnamate 4-monooxygenase OS=Vigna radiata var. radiata GN=CYP73A2 PE=1 SV=1 | 293 | 474 | 9.0E-13 |
| sp|Q9LIP5|C71BW_ARATH | Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 | 301 | 504 | 9.0E-13 |
| sp|Q08078|CP2CP_MESAU | Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 | 261 | 507 | 9.0E-13 |
| sp|E9Q816|CP2W1_MOUSE | Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 | 239 | 507 | 1.0E-12 |
| sp|P37123|C77A1_SOLME | Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 | 316 | 474 | 1.0E-12 |
| sp|Q9T0K2|C71AK_ARATH | Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 | 316 | 474 | 1.0E-12 |
| sp|Q6WKY9|C7D95_MENGR | Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 | 288 | 492 | 1.0E-12 |
| sp|Q6IV13|C7D95_MENSP | Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 | 288 | 492 | 1.0E-12 |
| sp|O49342|C71AD_ARATH | Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 | 177 | 492 | 1.0E-12 |
| sp|L7X3S1|MSH_PAPSO | Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 | 316 | 492 | 1.0E-12 |
| sp|Q43250|C71C1_MAIZE | 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 | 316 | 474 | 1.0E-12 |
| sp|Q9XHE7|C71DD_MENPI | Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 | 288 | 492 | 1.0E-12 |
| sp|P05182|CP2E1_RAT | Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 | 312 | 507 | 1.0E-12 |
| sp|Q27606|CP4E2_DROME | Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 | 104 | 474 | 1.0E-12 |
| sp|P93530|C71D6_SOLCH | Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 | 316 | 500 | 1.0E-12 |
| sp|P16496|CP52C_CANMA | Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 | 317 | 469 | 1.0E-12 |
| sp|D1MI46|C76BA_SWEMU | Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 | 316 | 460 | 1.0E-12 |
| sp|P33261|CP2CJ_HUMAN | Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 | 318 | 463 | 1.0E-12 |
| sp|Q9NGX9|CP302_DROME | Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2 | 280 | 500 | 1.0E-12 |
| sp|P19225|CP270_RAT | Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 | 131 | 463 | 1.0E-12 |
| sp|Q9LW27|C71BF_ARATH | Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 | 316 | 496 | 1.0E-12 |
| sp|P14779|CPXB_BACME | Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 | 308 | 474 | 1.0E-12 |
| sp|Q92113|CP17A_SQUAC | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 | 316 | 475 | 1.0E-12 |
| sp|F2Z9C1|P6H_ESCCA | Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 | 191 | 474 | 2.0E-12 |
| sp|Q9LVD2|C71BA_ARATH | Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 | 302 | 513 | 2.0E-12 |
| sp|Q54DT2|C516A_DICDI | Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 | 316 | 501 | 2.0E-12 |
| sp|O81077|ABAH2_ARATH | Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP707A2 PE=2 SV=1 | 251 | 486 | 2.0E-12 |
| sp|Q50EK4|C75A1_PINTA | Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 | 316 | 479 | 2.0E-12 |
| sp|Q8CIM7|CP2DQ_MOUSE | Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 | 244 | 478 | 2.0E-12 |
| sp|Q9V769|C6A22_DROME | Cytochrome P450 6a22 OS=Drosophila melanogaster GN=Cyp6a22 PE=2 SV=1 | 183 | 459 | 2.0E-12 |
| sp|Q6XVG2|CP254_MOUSE | Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 | 316 | 463 | 2.0E-12 |
| sp|P15149|CP2A2_RAT | Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 | 230 | 463 | 2.0E-12 |
| sp|Q87AX5|C1331_XYLFT | Putative cytochrome P450 133B1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cyp133B1 PE=3 SV=1 | 244 | 486 | 2.0E-12 |
| sp|Q6GUQ4|CP2E1_MACMU | Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 | 312 | 507 | 2.0E-12 |
| sp|P14137|CP11A_RAT | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 | 179 | 501 | 2.0E-12 |
| sp|O81972|C82A2_SOYBN | Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 | 289 | 474 | 2.0E-12 |
| sp|P13108|CP2D4_RAT | Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 | 274 | 463 | 2.0E-12 |
| sp|P05179|CP2C7_RAT | Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 | 131 | 509 | 2.0E-12 |
| sp|P37114|TCMO_MEDSA | Trans-cinnamate 4-monooxygenase OS=Medicago sativa GN=CYP73A3 PE=2 SV=1 | 129 | 470 | 2.0E-12 |
| sp|Q7KR10|CCD1D_DROME | Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 | 316 | 474 | 2.0E-12 |
| sp|Q2XV99|CP11A_MACFA | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Macaca fascicularis GN=CYP11A1 PE=2 SV=1 | 294 | 463 | 2.0E-12 |
| sp|O43174|CP26A_HUMAN | Cytochrome P450 26A1 OS=Homo sapiens GN=CYP26A1 PE=2 SV=2 | 288 | 470 | 2.0E-12 |
| sp|Q9QUJ1|CP2DS_MESAU | Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 | 244 | 463 | 2.0E-12 |
| sp|P79739|CP26A_DANRE | Cytochrome P450 26A1 OS=Danio rerio GN=cyp26a1 PE=2 SV=1 | 277 | 465 | 2.0E-12 |
| sp|A2Z212|ABAH3_ORYSI | Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. indica GN=CYP707A7 PE=3 SV=1 | 138 | 463 | 2.0E-12 |
| sp|B9GBJ9|C14C1_ORYSJ | Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 | 199 | 474 | 3.0E-12 |
| sp|Q54ZM4|C518A_DICDI | Probable cytochrome P450 518A1 OS=Dictyostelium discoideum GN=cyp518A1 PE=3 SV=1 | 317 | 474 | 3.0E-12 |
| sp|O55127|CP26A_MOUSE | Cytochrome P450 26A1 OS=Mus musculus GN=Cyp26a1 PE=2 SV=1 | 288 | 470 | 3.0E-12 |
| sp|O22203|C98A3_ARATH | Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 | 209 | 460 | 3.0E-12 |
| sp|O81974|C71D8_SOYBN | Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 | 316 | 507 | 3.0E-12 |
| sp|E3W9C4|C71A1_ZINZE | Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 | 316 | 492 | 3.0E-12 |
| sp|P24457|CP2DB_MOUSE | Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 | 274 | 478 | 3.0E-12 |
| sp|H2DH24|C7D47_PANGI | Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 | 358 | 474 | 3.0E-12 |
| sp|O73853|CP17A_ICTPU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 | 316 | 499 | 3.0E-12 |
| sp|Q27698|CP6D1_MUSDO | Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 | 297 | 474 | 3.0E-12 |
| sp|Q9VMT5|C28D1_DROME | Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 | 294 | 502 | 4.0E-12 |
| sp|F8S1H3|C7BL1_HELAN | Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 | 318 | 474 | 4.0E-12 |
| sp|E1B2Z9|C7AV8_CICIN | Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 | 288 | 492 | 4.0E-12 |
| sp|P10610|CP2G1_RAT | Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1 PE=2 SV=1 | 316 | 463 | 4.0E-12 |
| sp|Q9LJY7|C75AK_ARATH | Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 | 301 | 459 | 4.0E-12 |
| sp|Q0J185|ABAH3_ORYSJ | Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. japonica GN=CYP707A7 PE=2 SV=1 | 146 | 463 | 4.0E-12 |
| sp|P30437|CP17A_ONCMY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 | 273 | 463 | 4.0E-12 |
| sp|Q9LIP4|C71BX_ARATH | Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 | 302 | 474 | 5.0E-12 |
| sp|Q9W683|CP1A1_LIZSA | Cytochrome P450 1A1 OS=Liza saliens GN=cyp1a1 PE=2 SV=1 | 129 | 468 | 5.0E-12 |
| sp|Q9MZY0|CP2E1_CANLF | Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 | 312 | 463 | 5.0E-12 |
| sp|Q9PGC5|C1331_XYLFA | Putative cytochrome P450 133B1 OS=Xylella fastidiosa (strain 9a5c) GN=cyp133B1 PE=3 SV=1 | 252 | 486 | 5.0E-12 |
| sp|P70085|CP17A_ORYLA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 | 316 | 484 | 5.0E-12 |
| sp|Q5Z5S6|C7019_ORYSJ | Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 | 237 | 470 | 5.0E-12 |
| sp|P37121|C76A1_SOLME | Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 | 140 | 459 | 5.0E-12 |
| sp|Q9FVS9|C96AF_ARATH | Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 | 317 | 466 | 6.0E-12 |
| sp|Q6TBX7|LUT1_ARATH | Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 | 173 | 486 | 6.0E-12 |
| sp|Q9SP06|C80B3_PAPSO | (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 | 316 | 459 | 7.0E-12 |
| sp|H2DH21|C7A29_PANGI | Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 | 191 | 474 | 7.0E-12 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005506 | iron ion binding | Yes |
| GO:0004497 | monooxygenase activity | Yes |
| GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | Yes |
| GO:0020037 | heme binding | Yes |
| GO:0046914 | transition metal ion binding | No |
| GO:0046872 | metal ion binding | No |
| GO:0005488 | binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0016491 | oxidoreductase activity | No |
| GO:0003824 | catalytic activity | No |
| GO:0046906 | tetrapyrrole binding | No |
| GO:0003674 | molecular_function | No |
| GO:0043169 | cation binding | No |
| GO:0043167 | ion binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 19 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 4 | 18 | 14 |
| 2 | 55 | 74 | 19 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| SC16a | Pure fungal culture | 23.75 | 11.61 | 35.89 |
| CcL | In ants, during behavior modification | 248.89 | 65.20 | 432.58 |
| CcD | In ants, recently dead | 39.17 | 20.88 | 57.46 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| SC16a | CcL | 0.000286 | yes |
| SC16a | CcD | 0.032803 | yes |
| CcL | CcD | 0.000286 | yes |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophio5|1177 MGFVFGLLVVGVVLVVYSDGKGAGTVDFEVDGSRFDISLASRTTMPICAPSTQPIWYVITFLIVIIIIIIIIIFD PPIELSSLTYTLPPHPGPIVRVAPNEIDVCNPKTVKSIYGTRETFRKTDWYQDFTTKGVETVFNTVDVGVHRRLR RLLAGPISDISLRAYHDRIDHWARRAVEKIRREMVDRGAADVLKWFYFMATDILGDVTFGQSPGMLERGQKDEHS QYLENAMRLSAWRSAFPRLTAVASILPLPLFSDAQKSTRELTRFATRGLARRKSLVDDGTPPETIFRNLYQAQDR NEMSANEVRNEAELYFIAGGETTANTLTFLVWAVCRHAKVQATLLSELRTLPVDGFDDSLVRRLPYLDQVVHETL RLYGAAPSGLPRHVPAGGVELDGYWLAEGTTVCAQAYTLHRDPDIFADPNKFDPARWEEPSKAMRDAFMPFGKGT RSCLGIHLAMAELRMATARFFLAFPDARVSSLEGMSDDDMGEQNYFVMAPQGQRCLIEAASVVSEKSREDLVKDN L |
| Coding | >Ophio5|1177 ATGGGTTTCGTCTTTGGGTTGCTCGTTGTCGGCGTCGTGTTGGTCGTTTATTCCGACGGCAAAGGTGCCGGGACC GTGGATTTCGAGGTGGACGGAAGCCGTTTTGACATATCACTGGCTTCGAGGACGACGATGCCAATATGTGCACCA TCTACACAGCCGATATGGTACGTGATTACATTTCTTATCGTCATCATCATCATCATCATTATCATCATATTTGAT CCTCCCATCGAACTATCCTCACTCACTTACACCCTCCCCCCCCATCCAGGCCCAATCGTGCGCGTCGCCCCCAAC GAAATCGACGTCTGCAACCCAAAAACCGTGAAATCCATCTACGGCACACGCGAAACATTCCGCAAAACAGACTGG TATCAGGACTTCACCACCAAAGGCGTGGAAACCGTCTTCAACACCGTCGATGTTGGCGTCCATCGTCGGCTGCGT AGGCTCCTGGCTGGACCCATCTCTGACATTAGCTTGCGCGCTTATCATGATCGTATCGATCATTGGGCCCGTCGG GCTGTCGAGAAAATCCGTCGTGAGATGGTTGACAGGGGAGCTGCTGACGTCCTAAAGTGGTTTTACTTTATGGCT ACTGATATTCTTGGTGACGTGACGTTTGGTCAGTCGCCGGGTATGCTGGAAAGGGGACAGAAAGACGAGCACTCG CAATACCTCGAGAACGCCATGCGACTGTCTGCGTGGAGGTCGGCATTCCCGCGACTCACGGCCGTGGCATCCATC CTACCACTACCACTCTTCAGCGACGCCCAAAAGTCAACCCGTGAACTAACACGATTCGCCACGCGAGGCCTAGCG CGTCGCAAAAGCCTAGTGGATGACGGCACACCCCCCGAAACCATCTTCAGAAACCTCTACCAGGCGCAGGATCGT AACGAGATGAGCGCAAACGAAGTCCGCAACGAAGCCGAGCTATACTTTATCGCCGGCGGTGAAACGACGGCTAAC ACGTTGACCTTTTTGGTATGGGCCGTTTGCCGTCATGCCAAAGTCCAAGCGACGTTGCTGTCGGAGTTGCGCACG CTGCCGGTCGATGGATTCGACGACTCTCTCGTTCGAAGGCTGCCTTACCTCGATCAGGTCGTTCATGAGACTTTG CGGCTGTATGGGGCTGCGCCGTCGGGTTTGCCTAGACATGTGCCGGCCGGGGGAGTCGAGCTGGATGGGTATTGG CTTGCCGAGGGGACGACGGTGTGTGCGCAAGCGTATACACTGCATCGTGATCCGGACATCTTTGCGGATCCGAAT AAATTTGATCCGGCAAGATGGGAGGAGCCGAGCAAGGCGATGCGGGATGCCTTTATGCCGTTTGGGAAGGGGACG CGCAGCTGCCTCGGTATACATCTCGCCATGGCGGAGCTTCGTATGGCTACGGCGCGGTTCTTCCTCGCCTTTCCG GACGCCCGCGTGTCGAGTCTCGAGGGCATGAGTGATGATGACATGGGCGAGCAAAACTACTTTGTCATGGCGCCT CAGGGCCAGCGCTGTTTGATTGAGGCGGCTTCGGTGGTGTCGGAGAAGTCGAGGGAAGACCTTGTGAAAGACAAT TTG |
| Transcript | >Ophio5|1177 ATGGGTTTCGTCTTTGGGTTGCTCGTTGTCGGCGTCGTGTTGGTCGTTTATTCCGACGGCAAAGGTGCCGGGACC GTGGATTTCGAGGTGGACGGAAGCCGTTTTGACATATCACTGGCTTCGAGGACGACGATGCCAATATGTGCACCA TCTACACAGCCGATATGGTACGTGATTACATTTCTTATCGTCATCATCATCATCATCATTATCATCATATTTGAT CCTCCCATCGAACTATCCTCACTCACTTACACCCTCCCCCCCCATCCAGGCCCAATCGTGCGCGTCGCCCCCAAC GAAATCGACGTCTGCAACCCAAAAACCGTGAAATCCATCTACGGCACACGCGAAACATTCCGCAAAACAGACTGG TATCAGGACTTCACCACCAAAGGCGTGGAAACCGTCTTCAACACCGTCGATGTTGGCGTCCATCGTCGGCTGCGT AGGCTCCTGGCTGGACCCATCTCTGACATTAGCTTGCGCGCTTATCATGATCGTATCGATCATTGGGCCCGTCGG GCTGTCGAGAAAATCCGTCGTGAGATGGTTGACAGGGGAGCTGCTGACGTCCTAAAGTGGTTTTACTTTATGGCT ACTGATATTCTTGGTGACGTGACGTTTGGTCAGTCGCCGGGTATGCTGGAAAGGGGACAGAAAGACGAGCACTCG CAATACCTCGAGAACGCCATGCGACTGTCTGCGTGGAGGTCGGCATTCCCGCGACTCACGGCCGTGGCATCCATC CTACCACTACCACTCTTCAGCGACGCCCAAAAGTCAACCCGTGAACTAACACGATTCGCCACGCGAGGCCTAGCG CGTCGCAAAAGCCTAGTGGATGACGGCACACCCCCCGAAACCATCTTCAGAAACCTCTACCAGGCGCAGGATCGT AACGAGATGAGCGCAAACGAAGTCCGCAACGAAGCCGAGCTATACTTTATCGCCGGCGGTGAAACGACGGCTAAC ACGTTGACCTTTTTGGTATGGGCCGTTTGCCGTCATGCCAAAGTCCAAGCGACGTTGCTGTCGGAGTTGCGCACG CTGCCGGTCGATGGATTCGACGACTCTCTCGTTCGAAGGCTGCCTTACCTCGATCAGGTCGTTCATGAGACTTTG CGGCTGTATGGGGCTGCGCCGTCGGGTTTGCCTAGACATGTGCCGGCCGGGGGAGTCGAGCTGGATGGGTATTGG CTTGCCGAGGGGACGACGGTGTGTGCGCAAGCGTATACACTGCATCGTGATCCGGACATCTTTGCGGATCCGAAT AAATTTGATCCGGCAAGATGGGAGGAGCCGAGCAAGGCGATGCGGGATGCCTTTATGCCGTTTGGGAAGGGGACG CGCAGCTGCCTCGGTATACATCTCGCCATGGCGGAGCTTCGTATGGCTACGGCGCGGTTCTTCCTCGCCTTTCCG GACGCCCGCGTGTCGAGTCTCGAGGGCATGAGTGATGATGACATGGGCGAGCAAAACTACTTTGTCATGGCGCCT CAGGGCCAGCGCTGTTTGATTGAGGCGGCTTCGGTGGTGTCGGAGAAGTCGAGGGAAGACCTTGTGAAAGACAAT TTGTAG |
| Gene | >Ophio5|1177 ATGGGTTTCGTCTTTGGGTTGCTCGTTGTCGGCGTCGTGTTGGTCGTTTATGTGCGTTGAGGAGGAGAGATGGTG CCGTGTTGACTGGAGTCGGTAGCTGACGCTTCGGGTAGAAGACGTGCTGTGTGCTTTACAGTCCGACGGCAAAGG TGCCGGGACCGTGGATTTCGAGGTGGACGGAAGCCGTTTTGACATATCACTGGCTTCGAGGACGACGATGCCAAT ATGTGCACCATCTACACAGCCGATATGGTACGTGATTACATTTCTTATCGTCATCATCATCATCATCATTATCAT CATATTTGATCCTCCCATCGAACTATCCTCACTCACTTACACCCTCCCCCCCCATCCAGGCCCAATCGTGCGCGT CGCCCCCAACGAAATCGACGTCTGCAACCCAAAAACCGTGAAATCCATCTACGGCACACGCGAAACATTCCGCAA AACAGACTGGTATCAGGACTTCACCACCAAAGGCGTGGAAACCGTCTTCAACACCGTCGATGTTGGCGTCCATCG TCGGCTGCGTAGGCTCCTGGCTGGACCCATCTCTGACATTAGCTTGCGCGCTTATCATGATCGTATCGATCATTG GGCCCGTCGGGCTGTCGAGAAAATCCGTCGTGAGATGGTTGACAGGGGAGCTGCTGACGTCCTAAAGTGGTTTTA CTTTATGGCTACTGATATTCTTGGTGACGTGACGTTTGGTCAGTCGCCGGGTATGCTGGAAAGGGGACAGGTTGG GCATTTTTCGGTTTTCGACTCATTTTCTTCCTTTCTTGACGGCTGACGTGTCTCCATCCGTTTATAGAAAGACGA GCACTCGCAATACCTCGAGAACGCCATGCGACTGTCTGCGTGGAGGTCGGCATTCCCGCGACTCACGGCCGTGGC ATCCATCCTACCACTACCACTCTTCAGCGACGCCCAAAAGTCAACCCGTGAACTAACACGATTCGCCACGCGAGG CCTAGCGCGTCGCAAAAGCCTAGTGGATGACGGCACACCCCCCGAAACCATCTTCAGAAACCTCTACCAGGCGCA GGATCGTAACGAGATGAGCGCAAACGAAGTCCGCAACGAAGCCGAGCTATACTTTATCGCCGGCGGTGAAACGAC GGCTAACACGTTGACCTTTTTGGTATGGGCCGTTTGCCGTCATGCCAAAGTCCAAGCGACGTTGCTGTCGGAGTT GCGCACGCTGCCGGTCGATGGATTCGACGACTCTCTCGTTCGAAGGCTGCCTTACCTCGATCAGGTCGTTCATGA GACTTTGCGGCTGTATGGGGCTGCGCCGTCGGGTTTGCCTAGACATGTGCCGGCCGGGGGAGTCGAGCTGGATGG GTATTGGCTTGCCGAGGGGACGACGGTGTGTGCGCAAGCGTATACACTGCATCGTGATCCGGACATCTTTGCGGA TCCGAATAAATTTGATCCGGCAAGATGGGAGGAGCCGAGCAAGGCGATGCGGGATGCCTTTATGCCGTTTGGGAA GGGGACGCGCAGTGAGTATTTCTCGTCGTTTCCTACATGTTGATGACACTCGTTAACAAAGCCCAGGCTGCCTCG GTATACATCTCGCCATGGCGGAGCTTCGTATGGCTACGGCGCGGTTCTTCCTCGCCTTTCCGGACGCCCGCGTGT CGAGTCTCGAGGGCATGAGTGATGATGACATGGGCGAGCAAAACTACTTTGTCATGGCGCCTCAGGGCCAGCGCT GTTTGATTGAGGCGGCTTCGGTGGTGTCGGAGAAGTCGAGGGAAGACCTTGTGAAAGACAATTTGTAG |