Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1176
Gene name
Locationscaffold_138:12723..13763
Strand-
Gene length (bp)1040
Transcript length (bp)972
Coding sequence length (bp)969
Protein length (aa) 323

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein 3.0E-19 136 281
PF00633 HHH Helix-hairpin-helix motif 5.6E-07 213 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8VC05|NTH_EMENI Endonuclease III homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nth1 PE=3 SV=2 35 320 1.0E-100
sp|Q09907|NTH_SCHPO Endonuclease III homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nth1 PE=1 SV=1 85 321 7.0E-76
sp|Q2KID2|NTH_BOVIN Endonuclease III-like protein 1 OS=Bos taurus GN=NTHL1 PE=2 SV=1 45 321 8.0E-68
sp|A7M7B9|NTH_CHICK Endonuclease III-like protein 1 OS=Gallus gallus GN=NTHL1 PE=2 SV=1 45 310 2.0E-67
sp|P78549|NTH_HUMAN Endonuclease III-like protein 1 OS=Homo sapiens GN=NTHL1 PE=1 SV=2 52 321 9.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8VC05|NTH_EMENI Endonuclease III homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nth1 PE=3 SV=2 35 320 1.0E-100
sp|Q09907|NTH_SCHPO Endonuclease III homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nth1 PE=1 SV=1 85 321 7.0E-76
sp|Q2KID2|NTH_BOVIN Endonuclease III-like protein 1 OS=Bos taurus GN=NTHL1 PE=2 SV=1 45 321 8.0E-68
sp|A7M7B9|NTH_CHICK Endonuclease III-like protein 1 OS=Gallus gallus GN=NTHL1 PE=2 SV=1 45 310 2.0E-67
sp|P78549|NTH_HUMAN Endonuclease III-like protein 1 OS=Homo sapiens GN=NTHL1 PE=1 SV=2 52 321 9.0E-66
sp|O35980|NTH_MOUSE Endonuclease III-like protein 1 OS=Mus musculus GN=Nthl1 PE=2 SV=2 74 323 2.0E-65
sp|P54137|NTH_CAEEL Endonuclease III homolog OS=Caenorhabditis elegans GN=nth-1 PE=1 SV=2 88 310 6.0E-65
sp|Q9SIC4|NTH1_ARATH Endonuclease III homolog 1, chloroplastic OS=Arabidopsis thaliana GN=NTH1 PE=2 SV=2 41 321 4.0E-58
sp|P31378|NTH1_YEAST Endonuclease III homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTG1 PE=1 SV=1 83 301 1.0E-53
sp|B9DFZ0|NTH2_ARATH Endonuclease III homolog 2, chloroplastic OS=Arabidopsis thaliana GN=NTH2 PE=2 SV=1 87 321 1.0E-49
sp|Q8SRB8|NTH_ENCCU Endonuclease III homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=NTH1 PE=1 SV=1 112 318 2.0E-49
sp|Q08214|NTH2_YEAST Endonuclease III homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTG2 PE=1 SV=1 80 310 4.0E-49
sp|Q9WYK0|END3_THEMA Endonuclease III OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=nth PE=3 SV=1 132 312 3.0E-28
sp|Q58030|END3_METJA Endonuclease III OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=nth PE=3 SV=2 127 310 1.0E-22
sp|P73715|END3_SYNY3 Endonuclease III OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nth PE=3 SV=1 133 321 1.0E-17
sp|P46303|UVEN_MICLC Ultraviolet N-glycosylase/AP lyase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=pdg PE=1 SV=2 132 323 1.0E-15
sp|Q9CB92|END3_MYCLE Endonuclease III OS=Mycobacterium leprae (strain TN) GN=nth PE=3 SV=2 136 314 1.0E-14
sp|P39788|END3_BACSU Endonuclease III OS=Bacillus subtilis (strain 168) GN=nth PE=3 SV=1 132 319 7.0E-14
sp|P0AB83|END3_ECOLI Endonuclease III OS=Escherichia coli (strain K12) GN=nth PE=1 SV=1 132 310 6.0E-13
sp|P0AB84|END3_ECOL6 Endonuclease III OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nth PE=3 SV=1 132 310 6.0E-13
sp|P9WQ11|END3_MYCTU Endonuclease III OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nth PE=1 SV=1 179 314 4.0E-12
sp|P9WQ10|END3_MYCTO Endonuclease III OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nth PE=3 SV=1 179 314 4.0E-12
sp|P63541|END3_MYCBO Endonuclease III OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nth PE=3 SV=1 179 314 4.0E-12
sp|Q89AW4|END3_BUCBP Endonuclease III OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nth PE=3 SV=1 132 310 5.0E-12
sp|Q8KA16|END3_BUCAP Endonuclease III OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=nth PE=3 SV=1 184 310 3.0E-11
sp|Q4UK93|END3_RICFE Endonuclease III OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nth PE=3 SV=1 132 314 9.0E-11
sp|P44319|END3_HAEIN Endonuclease III OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=nth PE=3 SV=1 132 310 3.0E-10
sp|Q92GH4|END3_RICCN Endonuclease III OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nth PE=3 SV=1 132 314 3.0E-09
sp|Q68W04|END3_RICTY Endonuclease III OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nth PE=3 SV=1 132 314 4.0E-09
sp|P57219|END3_BUCAI Endonuclease III OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=nth PE=3 SV=1 132 314 1.0E-08
sp|O05956|END3_RICPR Endonuclease III OS=Rickettsia prowazekii (strain Madrid E) GN=nth PE=3 SV=1 132 314 4.0E-08
sp|O83754|END3_TREPA Endonuclease III OS=Treponema pallidum (strain Nichols) GN=nth PE=3 SV=1 132 318 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006284 base-excision repair Yes
GO:0003677 DNA binding Yes
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0050896 response to stimulus No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0033554 cellular response to stress No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0051716 cellular response to stimulus No
GO:0006807 nitrogen compound metabolic process No
GO:0006281 DNA repair No
GO:0006974 cellular response to DNA damage stimulus No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006950 response to stress No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1201 0.9406 0.0806 0.0203 0.3217 0.1017 0.0322 0.0078 0.0296 0.012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup105
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1376
Ophiocordyceps australis 1348a (Ghana) OphauG2|5000
Ophiocordyceps australis map64 (Brazil) OphauB2|2330
Ophiocordyceps australis map64 (Brazil) OphauB2|6638
Ophiocordyceps camponoti-floridani Ophcf2|02415
Ophiocordyceps camponoti-floridani Ophcf2|05427
Ophiocordyceps camponoti-floridani Ophcf2|05428
Ophiocordyceps camponoti-rufipedis Ophun1|2176
Ophiocordyceps camponoti-rufipedis Ophun1|6758
Ophiocordyceps kimflemingae Ophio5|1176 (this protein)
Ophiocordyceps kimflemingae Ophio5|1177
Ophiocordyceps kimflemingae Ophio5|4504
Ophiocordyceps subramaniannii Hirsu2|6059
Ophiocordyceps subramaniannii Hirsu2|667
Ophiocordyceps subramaniannii Hirsu2|826
Ophiocordyceps subramaniannii Hirsu2|9048

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1176
MASGRITRSASRAAMTATPTTGTVKMAKMTKVTTTTTTTMDMEDAVAPPAKRRKRAAPTLSVSTAGKPRARKPGH
GTAPTDETTTAPAGWEETYEAVRRMRAPGGVAYGAAVDTMGCERLADTRASAKDQRFQTLVALMLSSQTKDTVNA
AAMHRLKTELPPFRPGATAGLTVDNVLAADPVVLNELIRAVGFHNNKTKYLQQTAAVLRDRWDSDIPDSIAGLTA
LPGVGPKMAYLCLSAAWDRTEGIGVDVHVHRITNLWGWHRTRSPEETRRSLQAWLPQDRWREINGLLVGLGQVVC
RPVGRRCGECELGQRGMCRAAGN
Coding >Ophio5|1176
ATGGCGTCGGGACGTATCACACGATCTGCCTCCCGGGCAGCGATGACAGCGACGCCGACGACCGGGACAGTCAAG
ATGGCGAAGATGACAAAGGTGACGACGACAACAACCACCACCATGGATATGGAAGACGCCGTCGCCCCCCCGGCC
AAGCGCCGCAAACGAGCCGCGCCTACCCTCAGCGTCTCGACAGCCGGTAAGCCTAGAGCACGCAAGCCGGGCCAT
GGGACCGCTCCAACGGACGAGACAACGACAGCGCCCGCCGGCTGGGAAGAGACGTACGAAGCGGTGCGACGGATG
CGGGCGCCCGGAGGCGTAGCTTACGGCGCGGCAGTCGACACAATGGGCTGCGAGCGGTTAGCAGACACTCGGGCA
TCGGCCAAAGATCAGCGCTTCCAAACGCTGGTGGCATTGATGCTCTCGAGCCAAACCAAGGACACGGTCAATGCG
GCGGCCATGCACCGGCTCAAGACGGAGTTGCCGCCGTTCAGGCCCGGGGCGACGGCCGGGCTAACGGTGGACAAT
GTGCTGGCGGCGGACCCGGTGGTACTGAACGAGTTGATCCGGGCCGTGGGCTTTCACAACAACAAGACGAAATAT
CTCCAGCAGACGGCGGCGGTACTGCGCGACCGCTGGGACAGCGACATCCCCGATAGCATCGCCGGCCTGACGGCT
CTTCCCGGCGTTGGCCCCAAAATGGCCTATCTCTGCCTGTCTGCGGCCTGGGATCGCACTGAGGGCATCGGCGTT
GACGTGCACGTGCACCGCATCACCAACCTCTGGGGGTGGCATCGGACGCGCAGCCCCGAGGAGACGCGGAGGTCA
TTGCAGGCGTGGCTGCCTCAGGACCGGTGGCGTGAGATCAACGGACTTCTGGTCGGACTGGGGCAGGTCGTATGC
CGTCCGGTAGGGAGGCGTTGCGGCGAGTGCGAGCTGGGGCAACGAGGCATGTGCAGGGCGGCCGGAAAT
Transcript >Ophio5|1176
ATGGCGTCGGGACGTATCACACGATCTGCCTCCCGGGCAGCGATGACAGCGACGCCGACGACCGGGACAGTCAAG
ATGGCGAAGATGACAAAGGTGACGACGACAACAACCACCACCATGGATATGGAAGACGCCGTCGCCCCCCCGGCC
AAGCGCCGCAAACGAGCCGCGCCTACCCTCAGCGTCTCGACAGCCGGTAAGCCTAGAGCACGCAAGCCGGGCCAT
GGGACCGCTCCAACGGACGAGACAACGACAGCGCCCGCCGGCTGGGAAGAGACGTACGAAGCGGTGCGACGGATG
CGGGCGCCCGGAGGCGTAGCTTACGGCGCGGCAGTCGACACAATGGGCTGCGAGCGGTTAGCAGACACTCGGGCA
TCGGCCAAAGATCAGCGCTTCCAAACGCTGGTGGCATTGATGCTCTCGAGCCAAACCAAGGACACGGTCAATGCG
GCGGCCATGCACCGGCTCAAGACGGAGTTGCCGCCGTTCAGGCCCGGGGCGACGGCCGGGCTAACGGTGGACAAT
GTGCTGGCGGCGGACCCGGTGGTACTGAACGAGTTGATCCGGGCCGTGGGCTTTCACAACAACAAGACGAAATAT
CTCCAGCAGACGGCGGCGGTACTGCGCGACCGCTGGGACAGCGACATCCCCGATAGCATCGCCGGCCTGACGGCT
CTTCCCGGCGTTGGCCCCAAAATGGCCTATCTCTGCCTGTCTGCGGCCTGGGATCGCACTGAGGGCATCGGCGTT
GACGTGCACGTGCACCGCATCACCAACCTCTGGGGGTGGCATCGGACGCGCAGCCCCGAGGAGACGCGGAGGTCA
TTGCAGGCGTGGCTGCCTCAGGACCGGTGGCGTGAGATCAACGGACTTCTGGTCGGACTGGGGCAGGTCGTATGC
CGTCCGGTAGGGAGGCGTTGCGGCGAGTGCGAGCTGGGGCAACGAGGCATGTGCAGGGCGGCCGGAAATTGA
Gene >Ophio5|1176
ATGGCGTCGGGACGTATCACACGATCTGCCTCCCGGGCAGCGATGACAGCGACGCCGACGACCGGGACAGTCAAG
ATGGCGAAGATGACAAAGGTGACGACGACAACAACCACCACCATGGATATGGAAGACGCCGTCGCCCCCCCGGCC
AAGCGCCGCAAACGAGCCGCGCCTACCCTCAGCGTCTCGACAGCCGGTAAGCCTAGAGCACGCAAGCCGGGCCAT
GGGACCGCTCCAACGGACGAGACAACGACAGCGCCCGCCGGCTGGGAAGAGACGTACGAAGCGGTGCGACGGATG
CGGGCGCCCGGAGGCGTAGCTTACGGCGCGGCAGTCGACACAATGGGCTGCGAGCGGTTAGCAGACACTCGGGCA
TCGGCCAAAGATCAGCGCTTCCAAACGCTGGTGGCATTGATGCTCTCGAGCCAAACCAAGGACACGGTCAATGCG
GCGGCCATGCACCGGCTCAAGACGGAGTTGCCGCCGTTCAGGCCCGGGGCGACGGCCGGGCTAACGGTGGACAAT
GTGCTGGCGGCGGACCCGGTGGTACTGAACGAGTTGATCCGGGCCGTGGGCTTTCACAACAACAAGACGAAGTGC
GTACAAGCGGTTTGGCATTGTTTATCCCCCCCCCCGAAAAAAAAACCCCTTACTAATTGAACAGATATCTCCAGC
AGACGGCGGCGGTACTGCGCGACCGCTGGGACAGCGACATCCCCGATAGCATCGCCGGCCTGACGGCTCTTCCCG
GCGTTGGCCCCAAAATGGCCTATCTCTGCCTGTCTGCGGCCTGGGATCGCACTGAGGGCATCGGCGTTGACGTGC
ACGTGCACCGCATCACCAACCTCTGGGGGTGGCATCGGACGCGCAGCCCCGAGGAGACGCGGAGGTCATTGCAGG
CGTGGCTGCCTCAGGACCGGTGGCGTGAGATCAACGGACTTCTGGTCGGACTGGGGCAGGTCGTATGCCGTCCGG
TAGGGAGGCGTTGCGGCGAGTGCGAGCTGGGGCAACGAGGCATGTGCAGGGCGGCCGGAAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail