Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1169
Gene name
Locationscaffold_1375:263..895
Strand-
Gene length (bp)632
Transcript length (bp)567
Coding sequence length (bp)564
Protein length (aa) 188

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04893 Yip1 Yip1 domain 3.7E-13 50 183

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6P8|YIP4_SCHPO Protein YIP4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.13c PE=1 SV=1 49 187 3.0E-34
sp|Q96EC8|YIPF6_HUMAN Protein YIPF6 OS=Homo sapiens GN=YIPF6 PE=1 SV=2 25 178 7.0E-30
sp|A6QLC6|YIPF6_BOVIN Protein YIPF6 OS=Bos taurus GN=YIPF6 PE=2 SV=1 21 178 2.0E-29
sp|Q28CH8|YIPF6_XENTR Protein YIPF6 OS=Xenopus tropicalis GN=yipf6 PE=2 SV=1 49 178 6.0E-29
sp|Q8BR70|YIPF6_MOUSE Protein YIPF6 OS=Mus musculus GN=Yipf6 PE=1 SV=1 49 178 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6P8|YIP4_SCHPO Protein YIP4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.13c PE=1 SV=1 49 187 3.0E-34
sp|Q96EC8|YIPF6_HUMAN Protein YIPF6 OS=Homo sapiens GN=YIPF6 PE=1 SV=2 25 178 7.0E-30
sp|A6QLC6|YIPF6_BOVIN Protein YIPF6 OS=Bos taurus GN=YIPF6 PE=2 SV=1 21 178 2.0E-29
sp|Q28CH8|YIPF6_XENTR Protein YIPF6 OS=Xenopus tropicalis GN=yipf6 PE=2 SV=1 49 178 6.0E-29
sp|Q8BR70|YIPF6_MOUSE Protein YIPF6 OS=Mus musculus GN=Yipf6 PE=1 SV=1 49 178 1.0E-27
sp|Q4QQU5|YIPF6_RAT Protein YIPF6 OS=Rattus norvegicus GN=Yipf6 PE=1 SV=1 25 178 5.0E-27
sp|Q54RZ2|YIPF6_DICDI Protein YIPF6 homolog OS=Dictyostelium discoideum GN=yipf6 PE=3 SV=2 40 179 9.0E-27
sp|Q6IQ85|YIPF6_DANRE Protein YIPF6 OS=Danio rerio GN=yipf6 PE=2 SV=1 38 182 1.0E-26
sp|O94348|YIP1_SCHPO Protein transport protein yip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip1 PE=3 SV=1 49 178 7.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 54 72 18
2 79 96 17
3 106 128 22
4 141 163 22
5 168 187 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 174.48 95.46 253.51
CcL In ants, during behavior modification 171.05 90.78 251.33
CcD In ants, recently dead 172.91 90.64 255.17

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.945703 no
SC16a CcD 0.975864 no
CcL CcD 0.971526 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1169
MFDSERGLRGAYSNIRGAGISSTREELTGLASRIMDCEALLQSNMSSGLRDWDMWGPLIFCLLLSLLLSFTARSD
QKDAVFSGVFAIVWLGEAIVTLQIKLLGGYISFAQSVCIIGYTLFPLVLAALMSAVRLHWIARIPVYAVLISWSL
AAGVSILGGSGVVQNRVALAVYPLFVFYVGLGCLCFIS
Coding >Ophio5|1169
ATGTTCGATTCCGAGAGAGGTCTCCGCGGCGCCTATTCCAACATTCGTGGCGCAGGTATATCTAGTACGAGGGAA
GAGCTGACGGGTCTTGCGAGCCGTATCATGGATTGTGAGGCACTCCTGCAAAGCAACATGAGCTCTGGCTTGCGA
GACTGGGACATGTGGGGACCGCTCATATTCTGCTTGCTTCTGAGCTTGCTCCTTAGCTTCACCGCTCGGTCCGAT
CAAAAGGATGCCGTCTTCAGCGGAGTTTTCGCCATCGTATGGCTCGGTGAGGCTATTGTCACATTGCAAATCAAG
CTTTTAGGCGGATATATATCATTTGCACAGAGTGTATGCATCATCGGATACACACTTTTCCCTCTTGTGTTGGCT
GCTTTGATGTCTGCAGTCAGGCTTCACTGGATTGCACGAATTCCCGTTTACGCTGTCCTCATCTCGTGGTCCCTT
GCCGCCGGCGTAAGCATCTTGGGCGGGAGCGGCGTTGTGCAGAATCGCGTCGCCCTAGCTGTCTACCCTCTCTTC
GTGTTTTACGTCGGACTCGGCTGCCTCTGCTTTATTAGT
Transcript >Ophio5|1169
ATGTTCGATTCCGAGAGAGGTCTCCGCGGCGCCTATTCCAACATTCGTGGCGCAGGTATATCTAGTACGAGGGAA
GAGCTGACGGGTCTTGCGAGCCGTATCATGGATTGTGAGGCACTCCTGCAAAGCAACATGAGCTCTGGCTTGCGA
GACTGGGACATGTGGGGACCGCTCATATTCTGCTTGCTTCTGAGCTTGCTCCTTAGCTTCACCGCTCGGTCCGAT
CAAAAGGATGCCGTCTTCAGCGGAGTTTTCGCCATCGTATGGCTCGGTGAGGCTATTGTCACATTGCAAATCAAG
CTTTTAGGCGGATATATATCATTTGCACAGAGTGTATGCATCATCGGATACACACTTTTCCCTCTTGTGTTGGCT
GCTTTGATGTCTGCAGTCAGGCTTCACTGGATTGCACGAATTCCCGTTTACGCTGTCCTCATCTCGTGGTCCCTT
GCCGCCGGCGTAAGCATCTTGGGCGGGAGCGGCGTTGTGCAGAATCGCGTCGCCCTAGCTGTCTACCCTCTCTTC
GTGTTTTACGTCGGACTCGGCTGCCTCTGCTTTATTAGTTAA
Gene >Ophio5|1169
ATGTTCGATTCCGAGAGAGGTCTCCGCGGCGCCTATTCCAACATTCGTGGCGCAGGTATATCTAGTACGAGGGAA
GAGCTGACGGGTCTTGCGAGCCGTATCATGGATTGTGAGGCACTCCTGCAAAGCAACATGAGCTCTGGCTTGCGA
GACTGGGACATGTGGGGACCGCTCATATTCTGCTTGCTTCTGAGCTTGCTCCTTAGCTTCACCGCTCGGTCCGAT
CAAAAGGATGCCGTCTTCAGCGGAGTTTTCGCCATCGTATGGCTCGGTGAGGCTATTGTCACATTGCAAATCAAG
CTTTTAGGCGGATATATGTATGAGTGCAACTTTCCGCGAATTGCTCGCTTTCAAATGACTCAACTGCTGACGGTG
ATCCTAGATCATTTGCACAGAGTGTATGCATCATCGGATACACACTTTTCCCTCTTGTGTTGGCTGCTTTGATGT
CTGCAGTCAGGCTTCACTGGATTGCACGAATTCCCGTTTACGCTGTCCTCATCTCGTGGTCCCTTGCCGCCGGCG
TAAGCATCTTGGGCGGGAGCGGCGTTGTGCAGAATCGCGTCGCCCTAGCTGTCTACCCTCTCTTCGTGTTTTACG
TCGGACTCGGCTGCCTCTGCTTTATTAGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail