Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1169
Gene name
Locationscaffold_1375:263..895
Strand-
Gene length (bp)632
Transcript length (bp)567
Coding sequence length (bp)564
Protein length (aa) 188

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04893 Yip1 Yip1 domain 3.7E-13 50 183

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6P8|YIP4_SCHPO Protein YIP4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.13c PE=1 SV=1 49 187 3.0E-34
sp|Q96EC8|YIPF6_HUMAN Protein YIPF6 OS=Homo sapiens GN=YIPF6 PE=1 SV=2 25 178 7.0E-30
sp|A6QLC6|YIPF6_BOVIN Protein YIPF6 OS=Bos taurus GN=YIPF6 PE=2 SV=1 21 178 2.0E-29
sp|Q28CH8|YIPF6_XENTR Protein YIPF6 OS=Xenopus tropicalis GN=yipf6 PE=2 SV=1 49 178 6.0E-29
sp|Q8BR70|YIPF6_MOUSE Protein YIPF6 OS=Mus musculus GN=Yipf6 PE=1 SV=1 49 178 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6P8|YIP4_SCHPO Protein YIP4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.13c PE=1 SV=1 49 187 3.0E-34
sp|Q96EC8|YIPF6_HUMAN Protein YIPF6 OS=Homo sapiens GN=YIPF6 PE=1 SV=2 25 178 7.0E-30
sp|A6QLC6|YIPF6_BOVIN Protein YIPF6 OS=Bos taurus GN=YIPF6 PE=2 SV=1 21 178 2.0E-29
sp|Q28CH8|YIPF6_XENTR Protein YIPF6 OS=Xenopus tropicalis GN=yipf6 PE=2 SV=1 49 178 6.0E-29
sp|Q8BR70|YIPF6_MOUSE Protein YIPF6 OS=Mus musculus GN=Yipf6 PE=1 SV=1 49 178 1.0E-27
sp|Q4QQU5|YIPF6_RAT Protein YIPF6 OS=Rattus norvegicus GN=Yipf6 PE=1 SV=1 25 178 5.0E-27
sp|Q54RZ2|YIPF6_DICDI Protein YIPF6 homolog OS=Dictyostelium discoideum GN=yipf6 PE=3 SV=2 40 179 9.0E-27
sp|Q6IQ85|YIPF6_DANRE Protein YIPF6 OS=Danio rerio GN=yipf6 PE=2 SV=1 38 182 1.0E-26
sp|O94348|YIP1_SCHPO Protein transport protein yip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip1 PE=3 SV=1 49 178 7.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 54 72 18
2 79 96 17
3 106 128 22
4 141 163 22
5 168 187 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1169
MFDSERGLRGAYSNIRGAGISSTREELTGLASRIMDCEALLQSNMSSGLRDWDMWGPLIFCLLLSLLLSFTARSD
QKDAVFSGVFAIVWLGEAIVTLQIKLLGGYISFAQSVCIIGYTLFPLVLAALMSAVRLHWIARIPVYAVLISWSL
AAGVSILGGSGVVQNRVALAVYPLFVFYVGLGCLCFIS
Coding >Ophio5|1169
ATGTTCGATTCCGAGAGAGGTCTCCGCGGCGCCTATTCCAACATTCGTGGCGCAGGTATATCTAGTACGAGGGAA
GAGCTGACGGGTCTTGCGAGCCGTATCATGGATTGTGAGGCACTCCTGCAAAGCAACATGAGCTCTGGCTTGCGA
GACTGGGACATGTGGGGACCGCTCATATTCTGCTTGCTTCTGAGCTTGCTCCTTAGCTTCACCGCTCGGTCCGAT
CAAAAGGATGCCGTCTTCAGCGGAGTTTTCGCCATCGTATGGCTCGGTGAGGCTATTGTCACATTGCAAATCAAG
CTTTTAGGCGGATATATATCATTTGCACAGAGTGTATGCATCATCGGATACACACTTTTCCCTCTTGTGTTGGCT
GCTTTGATGTCTGCAGTCAGGCTTCACTGGATTGCACGAATTCCCGTTTACGCTGTCCTCATCTCGTGGTCCCTT
GCCGCCGGCGTAAGCATCTTGGGCGGGAGCGGCGTTGTGCAGAATCGCGTCGCCCTAGCTGTCTACCCTCTCTTC
GTGTTTTACGTCGGACTCGGCTGCCTCTGCTTTATTAGT
Transcript >Ophio5|1169
ATGTTCGATTCCGAGAGAGGTCTCCGCGGCGCCTATTCCAACATTCGTGGCGCAGGTATATCTAGTACGAGGGAA
GAGCTGACGGGTCTTGCGAGCCGTATCATGGATTGTGAGGCACTCCTGCAAAGCAACATGAGCTCTGGCTTGCGA
GACTGGGACATGTGGGGACCGCTCATATTCTGCTTGCTTCTGAGCTTGCTCCTTAGCTTCACCGCTCGGTCCGAT
CAAAAGGATGCCGTCTTCAGCGGAGTTTTCGCCATCGTATGGCTCGGTGAGGCTATTGTCACATTGCAAATCAAG
CTTTTAGGCGGATATATATCATTTGCACAGAGTGTATGCATCATCGGATACACACTTTTCCCTCTTGTGTTGGCT
GCTTTGATGTCTGCAGTCAGGCTTCACTGGATTGCACGAATTCCCGTTTACGCTGTCCTCATCTCGTGGTCCCTT
GCCGCCGGCGTAAGCATCTTGGGCGGGAGCGGCGTTGTGCAGAATCGCGTCGCCCTAGCTGTCTACCCTCTCTTC
GTGTTTTACGTCGGACTCGGCTGCCTCTGCTTTATTAGTTAA
Gene >Ophio5|1169
ATGTTCGATTCCGAGAGAGGTCTCCGCGGCGCCTATTCCAACATTCGTGGCGCAGGTATATCTAGTACGAGGGAA
GAGCTGACGGGTCTTGCGAGCCGTATCATGGATTGTGAGGCACTCCTGCAAAGCAACATGAGCTCTGGCTTGCGA
GACTGGGACATGTGGGGACCGCTCATATTCTGCTTGCTTCTGAGCTTGCTCCTTAGCTTCACCGCTCGGTCCGAT
CAAAAGGATGCCGTCTTCAGCGGAGTTTTCGCCATCGTATGGCTCGGTGAGGCTATTGTCACATTGCAAATCAAG
CTTTTAGGCGGATATATGTATGAGTGCAACTTTCCGCGAATTGCTCGCTTTCAAATGACTCAACTGCTGACGGTG
ATCCTAGATCATTTGCACAGAGTGTATGCATCATCGGATACACACTTTTCCCTCTTGTGTTGGCTGCTTTGATGT
CTGCAGTCAGGCTTCACTGGATTGCACGAATTCCCGTTTACGCTGTCCTCATCTCGTGGTCCCTTGCCGCCGGCG
TAAGCATCTTGGGCGGGAGCGGCGTTGTGCAGAATCGCGTCGCCCTAGCTGTCTACCCTCTCTTCGTGTTTTACG
TCGGACTCGGCTGCCTCTGCTTTATTAGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail