Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1157
Gene name
Locationscaffold_137:13467..15281
Strand-
Gene length (bp)1814
Transcript length (bp)1647
Coding sequence length (bp)1644
Protein length (aa) 548

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 1.9E-11 189 250
PF00013 KH_1 KH domain 5.0E-15 289 352
PF00013 KH_1 KH domain 3.1E-14 392 454

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 188 465 7.0E-27
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 188 461 2.0E-25
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 188 461 4.0E-25
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 188 461 5.0E-25
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 188 461 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 188 465 7.0E-27
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 188 461 2.0E-25
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 188 461 4.0E-25
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 188 461 5.0E-25
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 188 461 1.0E-23
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 188 461 6.0E-22
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 188 430 1.0E-21
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 188 430 1.0E-21
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 186 457 7.0E-13
sp|Q9LZ82|BTR1_ARATH Protein BTR1 OS=Arabidopsis thaliana GN=BTR1 PE=1 SV=1 193 464 2.0E-12
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 189 457 3.0E-11
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 189 457 4.0E-11
sp|Q9UNW9|NOVA2_HUMAN RNA-binding protein Nova-2 OS=Homo sapiens GN=NOVA2 PE=1 SV=1 264 458 5.0E-11
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 189 457 9.0E-11
sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 273 453 3.0E-10
sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=1 SV=3 273 453 5.0E-10
sp|P51513|NOVA1_HUMAN RNA-binding protein Nova-1 OS=Homo sapiens GN=NOVA1 PE=1 SV=1 264 426 1.0E-09
sp|Q9Y2W6|TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens GN=TDRKH PE=1 SV=2 284 457 5.0E-09
sp|Q80VL1|TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus GN=Tdrkh PE=1 SV=1 284 457 5.0E-09
sp|Q80WA4|NOVA1_RAT RNA-binding protein Nova-1 (Fragment) OS=Rattus norvegicus GN=Nova1 PE=2 SV=1 264 426 1.0E-08
sp|Q9JKN6|NOVA1_MOUSE RNA-binding protein Nova-1 OS=Mus musculus GN=Nova1 PE=1 SV=2 264 426 1.0E-08
sp|Q2PFW9|NOVA1_MACFA RNA-binding protein Nova-1 OS=Macaca fascicularis GN=NOVA1 PE=2 SV=1 264 426 1.0E-08
sp|Q9Y2W6|TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens GN=TDRKH PE=1 SV=2 183 357 1.0E-08
sp|Q61990|PCBP2_MOUSE Poly(rC)-binding protein 2 OS=Mus musculus GN=Pcbp2 PE=1 SV=1 274 453 3.0E-08
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 183 458 3.0E-08
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 183 458 3.0E-08
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 109 321 4.0E-08
sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1 274 453 4.0E-08
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 183 458 4.0E-08
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 183 458 5.0E-08
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 109 321 6.0E-08
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 109 321 8.0E-08
sp|Q08CK7|IF2B1_DANRE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Danio rerio GN=igf2bp1 PE=1 SV=1 182 470 3.0E-07
sp|Q5E9A3|PCBP1_BOVIN Poly(rC)-binding protein 1 OS=Bos taurus GN=PCBP1 PE=2 SV=1 288 453 8.0E-07
sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens GN=PCBP1 PE=1 SV=2 288 453 8.0E-07
sp|P60335|PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus GN=Pcbp1 PE=1 SV=1 288 453 8.0E-07
sp|O19048|PCBP1_RABIT Poly(rC)-binding protein 1 OS=Oryctolagus cuniculus GN=PCBP1 PE=2 SV=1 288 453 8.0E-07
sp|Q5RB68|IF2B2_PONAB Insulin-like growth factor 2 mRNA-binding protein 2 OS=Pongo abelii GN=IGF2BP2 PE=2 SV=1 191 441 9.0E-07
sp|Q5SF07|IF2B2_MOUSE Insulin-like growth factor 2 mRNA-binding protein 2 OS=Mus musculus GN=Igf2bp2 PE=1 SV=1 207 457 1.0E-06
sp|Q9SR13|FLK_ARATH Flowering locus K homology domain OS=Arabidopsis thaliana GN=FLK PE=1 SV=1 198 350 4.0E-06
sp|Q9LZ82|BTR1_ARATH Protein BTR1 OS=Arabidopsis thaliana GN=BTR1 PE=1 SV=1 287 457 5.0E-06
sp|P57723|PCBP4_HUMAN Poly(rC)-binding protein 4 OS=Homo sapiens GN=PCBP4 PE=2 SV=1 288 453 5.0E-06
sp|Q5RB68|IF2B2_PONAB Insulin-like growth factor 2 mRNA-binding protein 2 OS=Pongo abelii GN=IGF2BP2 PE=2 SV=1 288 457 6.0E-06
sp|Q0VCU0|PCBP4_BOVIN Poly(rC)-binding protein 4 OS=Bos taurus GN=PCBP4 PE=2 SV=1 288 453 6.0E-06
sp|Q9Y6M1|IF2B2_HUMAN Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens GN=IGF2BP2 PE=1 SV=2 288 457 6.0E-06
sp|P57724|PCBP4_MOUSE Poly(rC)-binding protein 4 OS=Mus musculus GN=Pcbp4 PE=1 SV=1 288 453 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.425 0.9086 0.0961 0.018 0.0323 0.0063 0.0352 0.0079 0.004 0.0008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2104
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3967
Ophiocordyceps australis map64 (Brazil) OphauB2|2543
Ophiocordyceps camponoti-floridani Ophcf2|04316
Ophiocordyceps camponoti-rufipedis Ophun1|4960
Ophiocordyceps kimflemingae Ophio5|1157 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2480

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1157
MAEPQPDIQSILAALASQRPPPSAPSHTPPSAPGHGYPTPATSTQPGGYQPPPPSAAAPPYGAPAHALPVPATSG
NVDLSAIRPVTSGTMSFDDVGSKARSFASDKVASSCDRPLVYGGDVRNNDRSYRRSRSRSPRAEYNRDERGGGHT
REYGRERSYSPPPRGRPFSPRGGNGRQRSPLRGADDNSETIQIESSLVGLIIGRQGENLRRIETDSKCRVQFLAA
TDGVPFRQCRISGPRQRRAEVKTAINRIIDDSGMGALNRPQEKPKDQNRGGAATTLRDGEDHMQIMVPDRTVGLI
IGRGGETIRDLQERSGCHINIVGESKSVNGLRPVNLIGTVEAATRAKDFIMEIVDSDTRGDGPAVKKAPAAGRAE
APPRDMGGGGQDKANDVIYVPSDAVGMIIGKGGETIRDMQNSTGCKINVAQSSGSGEVQREIGLIGTRDSIIRAK
QAIDEKVDAVRQKSGGGGGGGGSGGRSRVQPEADRAAYSQHPSINQAPQAACDSSDPYAQYGGYQNYVALWYQSL
MYQQQQQQGGQGPSAGAPAPGAQ
Coding >Ophio5|1157
ATGGCTGAACCTCAACCCGACATCCAAAGCATTCTAGCAGCGCTGGCCTCTCAGCGACCGCCGCCCTCTGCCCCG
AGCCACACACCCCCTAGTGCTCCTGGCCATGGCTATCCCACGCCAGCCACGTCGACGCAGCCAGGTGGCTACCAG
CCGCCGCCCCCTTCCGCCGCCGCCCCTCCCTATGGTGCCCCAGCCCACGCCCTTCCGGTGCCTGCGACTAGCGGA
AATGTCGACTTGAGCGCCATTCGGCCTGTAACTTCAGGTACCATGAGCTTCGACGACGTCGGTTCCAAGGCCAGA
TCTTTCGCCTCTGACAAGGTTGCGTCGTCCTGCGACCGGCCGCTTGTATACGGTGGTGATGTTAGAAACAACGAT
CGATCGTACCGTCGGTCAAGGTCCCGATCTCCTCGAGCCGAGTACAATAGGGACGAGCGCGGCGGTGGTCACACT
CGGGAATACGGACGCGAACGCTCATACTCACCCCCTCCTCGCGGCCGCCCCTTCTCGCCTCGAGGGGGCAATGGC
CGGCAAAGATCACCGTTACGAGGAGCCGACGATAACTCTGAGACGATTCAGATCGAGTCCAGCCTCGTCGGATTG
ATTATCGGTCGACAGGGCGAGAATCTCCGCCGCATAGAGACCGACTCCAAATGTCGCGTCCAGTTCCTGGCAGCC
ACGGATGGCGTTCCCTTCAGGCAGTGCAGAATCTCCGGTCCGCGTCAACGCCGCGCCGAGGTCAAGACCGCCATC
AACCGTATCATCGATGATAGCGGAATGGGTGCATTGAACCGACCGCAGGAAAAGCCCAAAGATCAGAATCGTGGT
GGCGCAGCGACGACACTGCGAGACGGCGAGGACCACATGCAGATTATGGTGCCGGATCGGACGGTGGGACTCATC
ATCGGTCGTGGGGGGGAGACGATTCGTGATCTGCAGGAAAGGTCGGGCTGTCACATCAACATCGTGGGAGAGTCG
AAGAGCGTCAACGGCTTGCGGCCCGTCAACTTGATTGGGACGGTCGAGGCGGCGACTCGAGCCAAGGACTTCATC
ATGGAGATCGTCGACAGCGACACCCGAGGCGACGGCCCCGCTGTCAAGAAGGCCCCCGCCGCCGGCCGAGCTGAG
GCGCCGCCAAGGGATATGGGCGGAGGCGGGCAGGATAAGGCCAACGACGTCATCTACGTTCCCTCCGATGCAGTG
GGCATGATAATCGGCAAGGGAGGGGAGACGATACGCGATATGCAGAACAGTACCGGGTGCAAGATCAACGTGGCC
CAGTCGTCCGGGTCCGGCGAGGTGCAGCGGGAGATTGGATTGATCGGGACACGCGATAGTATCATTCGCGCCAAG
CAGGCCATCGACGAGAAGGTGGATGCCGTGAGACAGAAGAGTGGCGGAGGCGGCGGCGGCGGAGGCAGCGGAGGC
CGGAGCCGCGTCCAGCCTGAGGCGGACCGAGCTGCCTACTCGCAGCACCCGTCCATTAACCAGGCACCGCAGGCA
GCGTGCGATTCCTCTGATCCCTACGCCCAATATGGCGGATACCAAAACTACGTGGCGCTCTGGTACCAGTCATTG
ATGTACCAGCAGCAGCAGCAACAAGGCGGACAAGGACCGTCGGCCGGAGCGCCAGCCCCGGGAGCCCAG
Transcript >Ophio5|1157
ATGGCTGAACCTCAACCCGACATCCAAAGCATTCTAGCAGCGCTGGCCTCTCAGCGACCGCCGCCCTCTGCCCCG
AGCCACACACCCCCTAGTGCTCCTGGCCATGGCTATCCCACGCCAGCCACGTCGACGCAGCCAGGTGGCTACCAG
CCGCCGCCCCCTTCCGCCGCCGCCCCTCCCTATGGTGCCCCAGCCCACGCCCTTCCGGTGCCTGCGACTAGCGGA
AATGTCGACTTGAGCGCCATTCGGCCTGTAACTTCAGGTACCATGAGCTTCGACGACGTCGGTTCCAAGGCCAGA
TCTTTCGCCTCTGACAAGGTTGCGTCGTCCTGCGACCGGCCGCTTGTATACGGTGGTGATGTTAGAAACAACGAT
CGATCGTACCGTCGGTCAAGGTCCCGATCTCCTCGAGCCGAGTACAATAGGGACGAGCGCGGCGGTGGTCACACT
CGGGAATACGGACGCGAACGCTCATACTCACCCCCTCCTCGCGGCCGCCCCTTCTCGCCTCGAGGGGGCAATGGC
CGGCAAAGATCACCGTTACGAGGAGCCGACGATAACTCTGAGACGATTCAGATCGAGTCCAGCCTCGTCGGATTG
ATTATCGGTCGACAGGGCGAGAATCTCCGCCGCATAGAGACCGACTCCAAATGTCGCGTCCAGTTCCTGGCAGCC
ACGGATGGCGTTCCCTTCAGGCAGTGCAGAATCTCCGGTCCGCGTCAACGCCGCGCCGAGGTCAAGACCGCCATC
AACCGTATCATCGATGATAGCGGAATGGGTGCATTGAACCGACCGCAGGAAAAGCCCAAAGATCAGAATCGTGGT
GGCGCAGCGACGACACTGCGAGACGGCGAGGACCACATGCAGATTATGGTGCCGGATCGGACGGTGGGACTCATC
ATCGGTCGTGGGGGGGAGACGATTCGTGATCTGCAGGAAAGGTCGGGCTGTCACATCAACATCGTGGGAGAGTCG
AAGAGCGTCAACGGCTTGCGGCCCGTCAACTTGATTGGGACGGTCGAGGCGGCGACTCGAGCCAAGGACTTCATC
ATGGAGATCGTCGACAGCGACACCCGAGGCGACGGCCCCGCTGTCAAGAAGGCCCCCGCCGCCGGCCGAGCTGAG
GCGCCGCCAAGGGATATGGGCGGAGGCGGGCAGGATAAGGCCAACGACGTCATCTACGTTCCCTCCGATGCAGTG
GGCATGATAATCGGCAAGGGAGGGGAGACGATACGCGATATGCAGAACAGTACCGGGTGCAAGATCAACGTGGCC
CAGTCGTCCGGGTCCGGCGAGGTGCAGCGGGAGATTGGATTGATCGGGACACGCGATAGTATCATTCGCGCCAAG
CAGGCCATCGACGAGAAGGTGGATGCCGTGAGACAGAAGAGTGGCGGAGGCGGCGGCGGCGGAGGCAGCGGAGGC
CGGAGCCGCGTCCAGCCTGAGGCGGACCGAGCTGCCTACTCGCAGCACCCGTCCATTAACCAGGCACCGCAGGCA
GCGTGCGATTCCTCTGATCCCTACGCCCAATATGGCGGATACCAAAACTACGTGGCGCTCTGGTACCAGTCATTG
ATGTACCAGCAGCAGCAGCAACAAGGCGGACAAGGACCGTCGGCCGGAGCGCCAGCCCCGGGAGCCCAGTGA
Gene >Ophio5|1157
ATGGCTGAACCTCAACCCGACATCCAAAGCATTCTAGCAGCGCTGGGTGAGATTCCTTTCGTCTCCGACCTCGAA
TACTCAGGCTCATCTTCACTCGCAGCCTCTCAGCGACCGCCGCCCTCTGCCCCGAGCCACACACCCCCTAGTGCT
CCTGGCCATGGCTATCCCACGCCAGCCACGTCGACGCAGCCAGGTGGCTACCAGCCGCCGCCCCCTTCCGCCGCC
GCCCCTCCCTATGGTGCCCCAGCCCACGCCCTTCCGGTGCCTGCGACTAGCGGAAATGTCGACTTGAGCGCCATT
CGGCCTGTAACTTCAGGTACCATGAGCTTCGACGACGTCGGTTCCAAGGCCAGATCTTTCGCCTCTGACAAGGTT
GCGTCGTCCTGCGACCGGCCGCTTGTATACGGTGGTGATGTTAGAAACAACGATCGATCGTACCGTCGGTCAAGG
TCCCGATCTCCTCGAGCCGAGTACAATAGGGACGAGCGCGGCGGTGGTCACACTCGGGAATACGGACGCGAACGC
TCATACTCACCCCCTCCTCGCGGCCGCCCCTTCTCGCCTCGAGGGGGCAATGGCCGGCAAAGATCACCGTTACGA
GGAGCCGACGATAACTCTGAGACGATTCAGATCGAGTCCAGCCTCGTCGGATTGATTATCGGTCGACAGGGCGAG
AATCTCCGCCGCATAGAGACCGACTCCAAATGTCGCGTCCAGTTCCTGGCAGCCACGGATGGCGTTCCCTTCAGG
CAGTGCAGAATCTCCGGTCCGCGTCAACGCCGCGCCGAGGTCAAGACCGCCATCAACCGTATCATCGATGATAGC
GGAATGGGTGCATTGAACCGACCGCAGGAAAAGCCCAAAGATCAGAATCGTGGTGGCGCAGCGACGACACTGCGA
GACGGCGAGGACCACATGCAGATTATGGTGCCGGATCGGACGGTGGGACTCATCATCGGTCGTGGGGGGGAGACG
ATTCGTGATCTGCAGGAAAGGTCGGGCTGTCACATCAACATCGTGGGAGAGTCGAAGAGCGTCAACGGCTTGCGG
CCCGTCAACTTGATTGGGACGGTCGAGGCGGCGACTCGAGCCAAGGACTTCATCATGGAGATCGTCGACAGCGAC
ACCCGAGGCGACGGCCCCGCTGTCAAGAAGGCCCCCGCCGCCGGCCGAGCTGAGGCGCCGCCAAGGGATATGGGC
GGAGGCGGGCAGGATAAGGCCAACGACGTCATCTACGTTCCCTCCGATGCAGTGGGCATGATAATCGGCAAGGGA
GGGGAGACGATACGCGATATGCAGAACAGTACCGGGTGCAAGATCAACGTGGCCCAGTCGTCCGGGTCCGGCGAG
GTGCAGCGGGAGATTGGATTGATCGGGACACGCGATAGTATCATTCGCGCCAAGCAGGCCATCGACGAGAAGGTG
GATGCCGTGGTATGTCTTCCATCTACTAGGGGCCGCCCCTCGGAGCCGGAGTTGACGACGACTTTGAAGAGACAG
AAGAGTGGCGGAGGCGGCGGCGGCGGAGGCAGCGGAGGCCGGAGCCGCGTCCAGCCTGAGGCGGACCGAGCTGCC
TACTCGCAGCACCCGTCCATTAACCAGGCACCGCAGGCAGCGTGCGATTCCTCTGATCCCTACGCCCAATGTGAG
TTGCCCGCCCTCTCCGCCGGCCCTGTCTGTACTGACGCAGCCTTCCAGATGGCGGATACCAAAACTACGTGGCGC
TCTGGTACCAGTCATTGATGTACCAGCAGCAGCAGCAACAAGGCGGACAAGGACCGTCGGCCGGAGCGCCAGCCC
CGGGAGCCCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail