Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1155
Gene name
Locationscaffold_137:8438..9918
Strand-
Gene length (bp)1480
Transcript length (bp)1323
Coding sequence length (bp)1320
Protein length (aa) 440

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 7.1E-33 107 437

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 115 437 6.0E-51
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 104 435 2.0E-18
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 110 431 1.0E-14
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 110 437 2.0E-14
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 110 437 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 115 437 6.0E-51
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 104 435 2.0E-18
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 110 431 1.0E-14
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 110 437 2.0E-14
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 110 437 3.0E-13
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 110 437 4.0E-13
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 163 437 9.0E-13
sp|O93885|PEPA_EMENI Aspartic protease pep1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pep1 PE=3 SV=1 92 437 1.0E-12
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 163 431 2.0E-12
sp|Q4WNV0|CTSD_ASPFU Aspartic-type endopeptidase ctsD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ctsD PE=1 SV=1 58 440 7.0E-12
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 110 437 2.0E-11
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 67 440 2.0E-11
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 67 440 7.0E-11
sp|Q9HEZ3|PEPB_PENJA Aspartic protease pepB OS=Penicillium janthinellum GN=pepB PE=3 SV=1 1 437 7.0E-11
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 104 437 8.0E-11
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 110 437 1.0E-10
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 164 437 1.0E-10
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 156 437 1.0E-09
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 101 440 2.0E-09
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 101 440 2.0E-09
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 104 429 2.0E-09
sp|P00798|PENP_PENJA Penicillopepsin OS=Penicillium janthinellum PE=1 SV=2 110 437 2.0E-09
sp|P53379|MKC7_YEAST Aspartic proteinase MKC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKC7 PE=1 SV=2 159 435 3.0E-09
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 83 430 6.0E-09
sp|O13340|CARP_PODAS Podosporapepsin OS=Podospora anserina GN=PAPA PE=2 SV=1 110 428 7.0E-09
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 104 437 1.0E-08
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 37 435 1.0E-08
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 162 435 2.0E-08
sp|Q9N2D2|CHYM_CALJA Chymosin OS=Callithrix jacchus GN=CYM PE=1 SV=1 84 429 2.0E-08
sp|P09177|CARP_RHIPU Mucorpepsin OS=Rhizomucor pusillus PE=1 SV=2 101 437 3.0E-08
sp|Q01972|PEPA_PENRO Aspartic protease pep1 OS=Penicillium roqueforti GN=pep1 PE=2 SV=1 115 440 4.0E-08
sp|O01530|ASP6_CAEEL Aspartic protease 6 OS=Caenorhabditis elegans GN=asp-6 PE=3 SV=1 67 437 6.0E-08
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 163 431 1.0E-07
sp|P41748|PEPA_ASPFU Aspartic protease pep1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep1 PE=1 SV=2 92 437 1.0E-07
sp|B0Y1V8|PEPA_ASPFC Aspartic protease pep1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pep1 PE=3 SV=1 92 437 1.0E-07
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 104 430 3.0E-07
sp|B6HL60|PEPA_PENRW Aspartic protease pep1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=pep1 PE=3 SV=1 115 440 5.0E-07
sp|E5A7T3|PEPA_LEPMJ Aspartic protease PEP1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=PEP1 PE=3 SV=2 98 429 8.0E-07
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 162 429 9.0E-07
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 104 429 9.0E-07
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 159 437 1.0E-06
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 163 431 2.0E-06
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 160 435 2.0E-06
sp|P78735|PEPA_PENJA Aspartic protease pepA OS=Penicillium janthinellum GN=pepA PE=1 SV=1 101 437 2.0E-06
sp|A1DDK1|PEPA_NEOFI Aspartic protease pep1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pep1 PE=3 SV=1 92 437 2.0E-06
sp|P00799|CARP_RHIMI Mucorpepsin OS=Rhizomucor miehei PE=1 SV=1 101 437 2.0E-06
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 164 435 3.0E-06
sp|B8MF81|PEPA_TALSN Aspartic protease pep1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=pep1 PE=3 SV=1 115 440 5.0E-06
sp|Q00663|CARP_CANTR Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 102 439 7.0E-06
sp|E5R1B9|PEPA_ARTGP Aspartic protease PEP1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=PEP1 PE=3 SV=1 34 437 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 53.04 28.80 77.28
CcL In ants, during behavior modification 24.12 11.22 37.01
CcD In ants, recently dead 17.07 7.40 26.74

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000997 yes
SC16a CcD 0.000286 yes
CcL CcD 0.216875 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1155
MKATRSLLALFGGGLALTRAMPEEAVDFSKPVGGLKLQQIKATRAATPDRTAAHFSRLQHVRNSHNEHPSTLSRA
LTLRTPPSRHENSYQNITRAGIYSTQYAIDCGWDGTPVWLLLDTGSADTWAVRSDYYCEDGLGGQVGCGFGWPLI
EDFAGGAIEDLHFSLRYGSGEKVRGPMGYSDLTCGGILVAEQQVGLANYTYWHGNNLTVGILGLAYPSITSAYYG
DFGTEAPWNAISYTPFLTSAIVQGAMDPVFSVALIKNSSEGILAWGGLPPLDWRRGKSATTDLIIANLIDQAETS
WRYSFYTIIPDGIKWGQTTDTTKFPYIVDTGTTMNYLPPPIAEAVANAFQPRAVYLYQWGSYFAPCHAVPPAFSI
IISGVEFSISAADLMYQDLKDPLTGYCAVAIASGGSGPYILGDVFLQNVVAVFDVGAAQMRFYSR
Coding >Ophio5|1155
ATGAAGGCGACCCGCTCGCTGCTGGCCCTCTTCGGAGGGGGCCTCGCCCTGACGCGGGCCATGCCAGAGGAAGCA
GTCGACTTCTCCAAGCCCGTTGGGGGGCTCAAGCTGCAGCAGATCAAAGCCACCCGAGCGGCGACGCCTGACCGG
ACGGCCGCTCACTTCTCACGTCTCCAGCACGTCCGGAACAGCCACAACGAGCACCCTTCGACTCTCAGCCGTGCT
CTGACCCTCCGGACTCCCCCTTCGCGGCACGAGAACAGCTACCAGAACATTACTCGGGCGGGCATCTACTCGACG
CAGTACGCCATCGACTGTGGCTGGGACGGCACGCCGGTATGGCTTCTCCTCGACACGGGCAGCGCCGACACGTGG
GCTGTCCGATCCGACTACTACTGCGAAGACGGCCTGGGCGGCCAGGTCGGCTGCGGCTTCGGCTGGCCACTCATC
GAAGACTTTGCCGGAGGCGCCATCGAGGATCTACACTTTTCGCTGCGCTACGGCTCGGGCGAGAAGGTCCGAGGG
CCGATGGGATACAGCGACCTGACGTGCGGTGGCATCCTGGTGGCGGAGCAACAGGTCGGGCTGGCAAACTACACG
TACTGGCATGGGAATAACCTGACGGTCGGCATCCTGGGGCTCGCCTACCCGTCCATCACGAGCGCCTATTACGGC
GACTTTGGCACAGAGGCTCCCTGGAACGCCATCTCCTACACGCCTTTTCTGACGAGCGCCATCGTCCAGGGCGCC
ATGGATCCCGTCTTCAGCGTGGCCCTCATCAAGAACTCGTCCGAGGGCATCCTTGCTTGGGGCGGCTTGCCGCCG
CTGGACTGGCGGCGGGGGAAGTCTGCGACGACGGACCTGATAATCGCCAACCTCATCGACCAGGCCGAGACGTCG
TGGCGATACTCGTTCTACACCATCATCCCGGACGGTATCAAATGGGGCCAAACGACGGACACGACCAAGTTTCCG
TATATTGTGGACACGGGTACGACGATGAATTATCTTCCACCTCCCATCGCCGAGGCCGTCGCCAATGCCTTCCAG
CCACGGGCCGTCTACCTGTACCAGTGGGGGTCGTACTTCGCGCCGTGCCACGCGGTGCCGCCGGCCTTTTCCATC
ATCATCTCGGGCGTCGAGTTCTCCATCAGTGCGGCCGATCTCATGTATCAGGACTTGAAGGATCCGTTGACGGGC
TACTGCGCCGTGGCCATTGCCAGTGGGGGGTCCGGGCCGTATATTCTCGGCGACGTGTTTCTGCAGAACGTCGTG
GCCGTCTTTGACGTGGGCGCGGCGCAGATGCGCTTCTACTCGCGG
Transcript >Ophio5|1155
ATGAAGGCGACCCGCTCGCTGCTGGCCCTCTTCGGAGGGGGCCTCGCCCTGACGCGGGCCATGCCAGAGGAAGCA
GTCGACTTCTCCAAGCCCGTTGGGGGGCTCAAGCTGCAGCAGATCAAAGCCACCCGAGCGGCGACGCCTGACCGG
ACGGCCGCTCACTTCTCACGTCTCCAGCACGTCCGGAACAGCCACAACGAGCACCCTTCGACTCTCAGCCGTGCT
CTGACCCTCCGGACTCCCCCTTCGCGGCACGAGAACAGCTACCAGAACATTACTCGGGCGGGCATCTACTCGACG
CAGTACGCCATCGACTGTGGCTGGGACGGCACGCCGGTATGGCTTCTCCTCGACACGGGCAGCGCCGACACGTGG
GCTGTCCGATCCGACTACTACTGCGAAGACGGCCTGGGCGGCCAGGTCGGCTGCGGCTTCGGCTGGCCACTCATC
GAAGACTTTGCCGGAGGCGCCATCGAGGATCTACACTTTTCGCTGCGCTACGGCTCGGGCGAGAAGGTCCGAGGG
CCGATGGGATACAGCGACCTGACGTGCGGTGGCATCCTGGTGGCGGAGCAACAGGTCGGGCTGGCAAACTACACG
TACTGGCATGGGAATAACCTGACGGTCGGCATCCTGGGGCTCGCCTACCCGTCCATCACGAGCGCCTATTACGGC
GACTTTGGCACAGAGGCTCCCTGGAACGCCATCTCCTACACGCCTTTTCTGACGAGCGCCATCGTCCAGGGCGCC
ATGGATCCCGTCTTCAGCGTGGCCCTCATCAAGAACTCGTCCGAGGGCATCCTTGCTTGGGGCGGCTTGCCGCCG
CTGGACTGGCGGCGGGGGAAGTCTGCGACGACGGACCTGATAATCGCCAACCTCATCGACCAGGCCGAGACGTCG
TGGCGATACTCGTTCTACACCATCATCCCGGACGGTATCAAATGGGGCCAAACGACGGACACGACCAAGTTTCCG
TATATTGTGGACACGGGTACGACGATGAATTATCTTCCACCTCCCATCGCCGAGGCCGTCGCCAATGCCTTCCAG
CCACGGGCCGTCTACCTGTACCAGTGGGGGTCGTACTTCGCGCCGTGCCACGCGGTGCCGCCGGCCTTTTCCATC
ATCATCTCGGGCGTCGAGTTCTCCATCAGTGCGGCCGATCTCATGTATCAGGACTTGAAGGATCCGTTGACGGGC
TACTGCGCCGTGGCCATTGCCAGTGGGGGGTCCGGGCCGTATATTCTCGGCGACGTGTTTCTGCAGAACGTCGTG
GCCGTCTTTGACGTGGGCGCGGCGCAGATGCGCTTCTACTCGCGGTGA
Gene >Ophio5|1155
ATGAAGGCGACCCGCTCGCTGCTGGCCCTCTTCGGAGGGGGCCTCGCCCTGACGCGGGCCATGCCAGAGGAAGCA
GTCGACTTCTCCAAGCCCGTTGGGGGGCTCAAGCTGCAGCAGATCAAAGCCACCCGAGCGGCGACGCCTGACCGG
ACGGCCGCTCACTTCTCACGTCTCCAGCACGTCCGGAACAGCCACAACGAGCACCCTTCGACTCTCAGCCGTGCT
CTGACCCTCCGGACTCCCCCTTCGCGGCACGAGAACAGCTACCAGAACATTACTCGGGCGGGCATCTACTCGACG
CAGTACGCCATCGACTGTGGCTGGGACGGCACGCCGGTATGGCTTCTCCTCGACACGGGCAGCGCCGACACGTGG
GCTGTCCGATCCGACTACTACTGCGAAGACGGCCTGGGCGGCCAGGTCGGCTGCGGCTTCGGCTGGCCACTCATC
GAAGACTTTGCCGGAGGCGCCATCGAGGATCTACACTTTTCGCTGCGCTACGGCTCGGGCGAGAAGGTCCGAGGG
CCGATGGGATACAGCGACCTGACGTGCGGTGGCATCCTGGTGGCGGAGCAACAGGTCGGGCTGGCAAACTACACG
TACTGGCATGGGAATAACCTGACGGTCGGCATCCTGGGGCTCGCCTACCCGTCCATCACGAGCGCCTATTACGGC
GACTTTGGCACAGAGGCTCCCTGGAACGCCATCTCCTACACGCCTTTTCTGACGAGCGCCATCGTCCAGGGCGCC
ATGGATCCCGTCTTCAGCGTGGCCCTCATCAAGAACTCGTCCGAGGGCATCCTTGCTTGGGGCGGCTTGCCGCCG
CTGGACTGGCGGCGGGGGAAGTCTGCGACGACGGACCTGATAATCGTGAGTTGATTTGGGAAAGACAGGAGCTTA
ATATGGGGGAAACCGCTTGATAGCGAGCAGCTTGACATCTGGCTGACATGGCATTCAGGCCAACCTCATCGACCA
GGCCGAGACGTCGTGGCGATACTCGTTCTACACCATCATCCCGGACGGTATCAAATGGGGCCAAACGACGGACAC
GACCAAGTTTCCGTATATTGTGGACACGGGTACGACGATGAATTATCTTCCACCTCGTGCGTTCTCCCCTTTGCC
CCTCCCCTCCCTCGAGGGGGAACCTTGGAGGCTAAGACGAAGGTGACCAGCCATCGCCGAGGCCGTCGCCAATGC
CTTCCAGCCACGGGCCGTCTACCTGTACCAGTGGGGGTCGTACTTCGCGCCGTGCCACGCGGTGCCGCCGGCCTT
TTCCATCATCATCTCGGGCGTCGAGTTCTCCATCAGTGCGGCCGATCTCATGTATCAGGACTTGAAGGATCCGTT
GACGGGCTACTGCGCCGTGGCCATTGCCAGTGGGGGGTCCGGGCCGTATATTCTCGGCGACGTGTTTCTGCAGAA
CGTCGTGGCCGTCTTTGACGTGGGCGCGGCGCAGATGCGCTTCTACTCGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail