Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1155
Gene name
Locationscaffold_137:8438..9918
Strand-
Gene length (bp)1480
Transcript length (bp)1323
Coding sequence length (bp)1320
Protein length (aa) 440

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 7.1E-33 107 437

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 115 437 6.0E-51
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 104 435 2.0E-18
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 110 431 1.0E-14
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 110 437 2.0E-14
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 110 437 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 115 437 6.0E-51
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 104 435 2.0E-18
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 110 431 1.0E-14
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 110 437 2.0E-14
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 110 437 3.0E-13
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 110 437 4.0E-13
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 163 437 9.0E-13
sp|O93885|PEPA_EMENI Aspartic protease pep1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pep1 PE=3 SV=1 92 437 1.0E-12
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 163 431 2.0E-12
sp|Q4WNV0|CTSD_ASPFU Aspartic-type endopeptidase ctsD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ctsD PE=1 SV=1 58 440 7.0E-12
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 110 437 2.0E-11
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 67 440 2.0E-11
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 67 440 7.0E-11
sp|Q9HEZ3|PEPB_PENJA Aspartic protease pepB OS=Penicillium janthinellum GN=pepB PE=3 SV=1 1 437 7.0E-11
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 104 437 8.0E-11
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 110 437 1.0E-10
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 164 437 1.0E-10
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 156 437 1.0E-09
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 101 440 2.0E-09
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 101 440 2.0E-09
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 104 429 2.0E-09
sp|P00798|PENP_PENJA Penicillopepsin OS=Penicillium janthinellum PE=1 SV=2 110 437 2.0E-09
sp|P53379|MKC7_YEAST Aspartic proteinase MKC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKC7 PE=1 SV=2 159 435 3.0E-09
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 83 430 6.0E-09
sp|O13340|CARP_PODAS Podosporapepsin OS=Podospora anserina GN=PAPA PE=2 SV=1 110 428 7.0E-09
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 104 437 1.0E-08
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 37 435 1.0E-08
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 162 435 2.0E-08
sp|Q9N2D2|CHYM_CALJA Chymosin OS=Callithrix jacchus GN=CYM PE=1 SV=1 84 429 2.0E-08
sp|P09177|CARP_RHIPU Mucorpepsin OS=Rhizomucor pusillus PE=1 SV=2 101 437 3.0E-08
sp|Q01972|PEPA_PENRO Aspartic protease pep1 OS=Penicillium roqueforti GN=pep1 PE=2 SV=1 115 440 4.0E-08
sp|O01530|ASP6_CAEEL Aspartic protease 6 OS=Caenorhabditis elegans GN=asp-6 PE=3 SV=1 67 437 6.0E-08
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 163 431 1.0E-07
sp|P41748|PEPA_ASPFU Aspartic protease pep1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep1 PE=1 SV=2 92 437 1.0E-07
sp|B0Y1V8|PEPA_ASPFC Aspartic protease pep1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pep1 PE=3 SV=1 92 437 1.0E-07
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 104 430 3.0E-07
sp|B6HL60|PEPA_PENRW Aspartic protease pep1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=pep1 PE=3 SV=1 115 440 5.0E-07
sp|E5A7T3|PEPA_LEPMJ Aspartic protease PEP1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=PEP1 PE=3 SV=2 98 429 8.0E-07
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 162 429 9.0E-07
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 104 429 9.0E-07
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 159 437 1.0E-06
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 163 431 2.0E-06
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 160 435 2.0E-06
sp|P78735|PEPA_PENJA Aspartic protease pepA OS=Penicillium janthinellum GN=pepA PE=1 SV=1 101 437 2.0E-06
sp|A1DDK1|PEPA_NEOFI Aspartic protease pep1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pep1 PE=3 SV=1 92 437 2.0E-06
sp|P00799|CARP_RHIMI Mucorpepsin OS=Rhizomucor miehei PE=1 SV=1 101 437 2.0E-06
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 164 435 3.0E-06
sp|B8MF81|PEPA_TALSN Aspartic protease pep1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=pep1 PE=3 SV=1 115 440 5.0E-06
sp|Q00663|CARP_CANTR Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 102 439 7.0E-06
sp|E5R1B9|PEPA_ARTGP Aspartic protease PEP1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=PEP1 PE=3 SV=1 34 437 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1155
MKATRSLLALFGGGLALTRAMPEEAVDFSKPVGGLKLQQIKATRAATPDRTAAHFSRLQHVRNSHNEHPSTLSRA
LTLRTPPSRHENSYQNITRAGIYSTQYAIDCGWDGTPVWLLLDTGSADTWAVRSDYYCEDGLGGQVGCGFGWPLI
EDFAGGAIEDLHFSLRYGSGEKVRGPMGYSDLTCGGILVAEQQVGLANYTYWHGNNLTVGILGLAYPSITSAYYG
DFGTEAPWNAISYTPFLTSAIVQGAMDPVFSVALIKNSSEGILAWGGLPPLDWRRGKSATTDLIIANLIDQAETS
WRYSFYTIIPDGIKWGQTTDTTKFPYIVDTGTTMNYLPPPIAEAVANAFQPRAVYLYQWGSYFAPCHAVPPAFSI
IISGVEFSISAADLMYQDLKDPLTGYCAVAIASGGSGPYILGDVFLQNVVAVFDVGAAQMRFYSR
Coding >Ophio5|1155
ATGAAGGCGACCCGCTCGCTGCTGGCCCTCTTCGGAGGGGGCCTCGCCCTGACGCGGGCCATGCCAGAGGAAGCA
GTCGACTTCTCCAAGCCCGTTGGGGGGCTCAAGCTGCAGCAGATCAAAGCCACCCGAGCGGCGACGCCTGACCGG
ACGGCCGCTCACTTCTCACGTCTCCAGCACGTCCGGAACAGCCACAACGAGCACCCTTCGACTCTCAGCCGTGCT
CTGACCCTCCGGACTCCCCCTTCGCGGCACGAGAACAGCTACCAGAACATTACTCGGGCGGGCATCTACTCGACG
CAGTACGCCATCGACTGTGGCTGGGACGGCACGCCGGTATGGCTTCTCCTCGACACGGGCAGCGCCGACACGTGG
GCTGTCCGATCCGACTACTACTGCGAAGACGGCCTGGGCGGCCAGGTCGGCTGCGGCTTCGGCTGGCCACTCATC
GAAGACTTTGCCGGAGGCGCCATCGAGGATCTACACTTTTCGCTGCGCTACGGCTCGGGCGAGAAGGTCCGAGGG
CCGATGGGATACAGCGACCTGACGTGCGGTGGCATCCTGGTGGCGGAGCAACAGGTCGGGCTGGCAAACTACACG
TACTGGCATGGGAATAACCTGACGGTCGGCATCCTGGGGCTCGCCTACCCGTCCATCACGAGCGCCTATTACGGC
GACTTTGGCACAGAGGCTCCCTGGAACGCCATCTCCTACACGCCTTTTCTGACGAGCGCCATCGTCCAGGGCGCC
ATGGATCCCGTCTTCAGCGTGGCCCTCATCAAGAACTCGTCCGAGGGCATCCTTGCTTGGGGCGGCTTGCCGCCG
CTGGACTGGCGGCGGGGGAAGTCTGCGACGACGGACCTGATAATCGCCAACCTCATCGACCAGGCCGAGACGTCG
TGGCGATACTCGTTCTACACCATCATCCCGGACGGTATCAAATGGGGCCAAACGACGGACACGACCAAGTTTCCG
TATATTGTGGACACGGGTACGACGATGAATTATCTTCCACCTCCCATCGCCGAGGCCGTCGCCAATGCCTTCCAG
CCACGGGCCGTCTACCTGTACCAGTGGGGGTCGTACTTCGCGCCGTGCCACGCGGTGCCGCCGGCCTTTTCCATC
ATCATCTCGGGCGTCGAGTTCTCCATCAGTGCGGCCGATCTCATGTATCAGGACTTGAAGGATCCGTTGACGGGC
TACTGCGCCGTGGCCATTGCCAGTGGGGGGTCCGGGCCGTATATTCTCGGCGACGTGTTTCTGCAGAACGTCGTG
GCCGTCTTTGACGTGGGCGCGGCGCAGATGCGCTTCTACTCGCGG
Transcript >Ophio5|1155
ATGAAGGCGACCCGCTCGCTGCTGGCCCTCTTCGGAGGGGGCCTCGCCCTGACGCGGGCCATGCCAGAGGAAGCA
GTCGACTTCTCCAAGCCCGTTGGGGGGCTCAAGCTGCAGCAGATCAAAGCCACCCGAGCGGCGACGCCTGACCGG
ACGGCCGCTCACTTCTCACGTCTCCAGCACGTCCGGAACAGCCACAACGAGCACCCTTCGACTCTCAGCCGTGCT
CTGACCCTCCGGACTCCCCCTTCGCGGCACGAGAACAGCTACCAGAACATTACTCGGGCGGGCATCTACTCGACG
CAGTACGCCATCGACTGTGGCTGGGACGGCACGCCGGTATGGCTTCTCCTCGACACGGGCAGCGCCGACACGTGG
GCTGTCCGATCCGACTACTACTGCGAAGACGGCCTGGGCGGCCAGGTCGGCTGCGGCTTCGGCTGGCCACTCATC
GAAGACTTTGCCGGAGGCGCCATCGAGGATCTACACTTTTCGCTGCGCTACGGCTCGGGCGAGAAGGTCCGAGGG
CCGATGGGATACAGCGACCTGACGTGCGGTGGCATCCTGGTGGCGGAGCAACAGGTCGGGCTGGCAAACTACACG
TACTGGCATGGGAATAACCTGACGGTCGGCATCCTGGGGCTCGCCTACCCGTCCATCACGAGCGCCTATTACGGC
GACTTTGGCACAGAGGCTCCCTGGAACGCCATCTCCTACACGCCTTTTCTGACGAGCGCCATCGTCCAGGGCGCC
ATGGATCCCGTCTTCAGCGTGGCCCTCATCAAGAACTCGTCCGAGGGCATCCTTGCTTGGGGCGGCTTGCCGCCG
CTGGACTGGCGGCGGGGGAAGTCTGCGACGACGGACCTGATAATCGCCAACCTCATCGACCAGGCCGAGACGTCG
TGGCGATACTCGTTCTACACCATCATCCCGGACGGTATCAAATGGGGCCAAACGACGGACACGACCAAGTTTCCG
TATATTGTGGACACGGGTACGACGATGAATTATCTTCCACCTCCCATCGCCGAGGCCGTCGCCAATGCCTTCCAG
CCACGGGCCGTCTACCTGTACCAGTGGGGGTCGTACTTCGCGCCGTGCCACGCGGTGCCGCCGGCCTTTTCCATC
ATCATCTCGGGCGTCGAGTTCTCCATCAGTGCGGCCGATCTCATGTATCAGGACTTGAAGGATCCGTTGACGGGC
TACTGCGCCGTGGCCATTGCCAGTGGGGGGTCCGGGCCGTATATTCTCGGCGACGTGTTTCTGCAGAACGTCGTG
GCCGTCTTTGACGTGGGCGCGGCGCAGATGCGCTTCTACTCGCGGTGA
Gene >Ophio5|1155
ATGAAGGCGACCCGCTCGCTGCTGGCCCTCTTCGGAGGGGGCCTCGCCCTGACGCGGGCCATGCCAGAGGAAGCA
GTCGACTTCTCCAAGCCCGTTGGGGGGCTCAAGCTGCAGCAGATCAAAGCCACCCGAGCGGCGACGCCTGACCGG
ACGGCCGCTCACTTCTCACGTCTCCAGCACGTCCGGAACAGCCACAACGAGCACCCTTCGACTCTCAGCCGTGCT
CTGACCCTCCGGACTCCCCCTTCGCGGCACGAGAACAGCTACCAGAACATTACTCGGGCGGGCATCTACTCGACG
CAGTACGCCATCGACTGTGGCTGGGACGGCACGCCGGTATGGCTTCTCCTCGACACGGGCAGCGCCGACACGTGG
GCTGTCCGATCCGACTACTACTGCGAAGACGGCCTGGGCGGCCAGGTCGGCTGCGGCTTCGGCTGGCCACTCATC
GAAGACTTTGCCGGAGGCGCCATCGAGGATCTACACTTTTCGCTGCGCTACGGCTCGGGCGAGAAGGTCCGAGGG
CCGATGGGATACAGCGACCTGACGTGCGGTGGCATCCTGGTGGCGGAGCAACAGGTCGGGCTGGCAAACTACACG
TACTGGCATGGGAATAACCTGACGGTCGGCATCCTGGGGCTCGCCTACCCGTCCATCACGAGCGCCTATTACGGC
GACTTTGGCACAGAGGCTCCCTGGAACGCCATCTCCTACACGCCTTTTCTGACGAGCGCCATCGTCCAGGGCGCC
ATGGATCCCGTCTTCAGCGTGGCCCTCATCAAGAACTCGTCCGAGGGCATCCTTGCTTGGGGCGGCTTGCCGCCG
CTGGACTGGCGGCGGGGGAAGTCTGCGACGACGGACCTGATAATCGTGAGTTGATTTGGGAAAGACAGGAGCTTA
ATATGGGGGAAACCGCTTGATAGCGAGCAGCTTGACATCTGGCTGACATGGCATTCAGGCCAACCTCATCGACCA
GGCCGAGACGTCGTGGCGATACTCGTTCTACACCATCATCCCGGACGGTATCAAATGGGGCCAAACGACGGACAC
GACCAAGTTTCCGTATATTGTGGACACGGGTACGACGATGAATTATCTTCCACCTCGTGCGTTCTCCCCTTTGCC
CCTCCCCTCCCTCGAGGGGGAACCTTGGAGGCTAAGACGAAGGTGACCAGCCATCGCCGAGGCCGTCGCCAATGC
CTTCCAGCCACGGGCCGTCTACCTGTACCAGTGGGGGTCGTACTTCGCGCCGTGCCACGCGGTGCCGCCGGCCTT
TTCCATCATCATCTCGGGCGTCGAGTTCTCCATCAGTGCGGCCGATCTCATGTATCAGGACTTGAAGGATCCGTT
GACGGGCTACTGCGCCGTGGCCATTGCCAGTGGGGGGTCCGGGCCGTATATTCTCGGCGACGTGTTTCTGCAGAA
CGTCGTGGCCGTCTTTGACGTGGGCGCGGCGCAGATGCGCTTCTACTCGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail