Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1154
Gene name
Locationscaffold_137:5469..7801
Strand-
Gene length (bp)2332
Transcript length (bp)1383
Coding sequence length (bp)1380
Protein length (aa) 460

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01591 6PF2K 6-phosphofructo-2-kinase 1.4E-76 27 243
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 3.8E-33 246 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 26 449 1.0E-179
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 37 460 2.0E-141
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 37 460 3.0E-141
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 37 460 8.0E-141
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 37 460 3.0E-140
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 26 449 1.0E-179
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 37 460 2.0E-141
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 37 460 3.0E-141
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 37 460 8.0E-141
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 37 460 3.0E-140
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 9 446 1.0E-138
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 29 451 1.0E-138
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 12 459 2.0E-138
sp|Q9JJH5|F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus GN=Pfkfb2 PE=1 SV=1 12 459 7.0E-138
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 29 451 9.0E-138
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 29 451 2.0E-137
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 19 460 3.0E-137
sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=1 SV=2 19 446 6.0E-137
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 9 446 1.0E-136
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 17 446 1.0E-136
sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2 24 456 2.0E-136
sp|P26285|F262_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Bos taurus GN=PFKFB2 PE=1 SV=2 24 446 6.0E-136
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 9 446 2.0E-135
sp|Q5NVT1|F262_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Pongo abelii GN=PFKFB2 PE=2 SV=1 24 456 4.0E-135
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 29 451 5.0E-133
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 37 437 3.0E-127
sp|Q9URZ7|YK72_SCHPO Probable fructose-2,6-bisphosphatase C732.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC732.02c PE=3 SV=1 35 446 1.0E-114
sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 31 434 5.0E-113
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 32 433 3.0E-96
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 33 427 5.0E-90
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 34 433 1.0E-84
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 34 441 5.0E-53
sp|Q9UTK9|YIVH_SCHPO Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase C144.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.17c PE=1 SV=2 34 427 2.0E-37
sp|D3DFG8|PSPA_HYDTT Phosphoserine phosphatase 1 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspA PE=1 SV=1 248 407 2.0E-12
sp|Q7NJF7|GPMA2_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA2 PE=3 SV=1 248 396 2.0E-07
sp|Q12471|6P22_YEAST 6-phosphofructo-2-kinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK27 PE=1 SV=1 24 191 3.0E-07
sp|Q9FNJ9|CA1P_ARATH Probable 2-carboxy-D-arabinitol-1-phosphatase OS=Arabidopsis thaliana GN=At5g22620 PE=1 SV=1 244 398 1.0E-06
sp|Q9SCS3|PGML4_ARATH Phosphoglycerate mutase-like protein 4 OS=Arabidopsis thaliana GN=At3g50520 PE=2 SV=1 246 397 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006000 fructose metabolic process Yes
GO:0003873 6-phosphofructo-2-kinase activity Yes
GO:0005524 ATP binding Yes
GO:0019200 carbohydrate kinase activity No
GO:0005996 monosaccharide metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0030554 adenyl nucleotide binding No
GO:0008152 metabolic process No
GO:0043167 ion binding No
GO:0005975 carbohydrate metabolic process No
GO:0044238 primary metabolic process No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0044281 small molecule metabolic process No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0019318 hexose metabolic process No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0016301 kinase activity No
GO:0036094 small molecule binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0032559 adenyl ribonucleotide binding No
GO:0008443 phosphofructokinase activity No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6978 0.4825 0.0118 0.1699 0.1608 0.0137 0.1553 0.2377 0.0954 0.0174

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1471
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7490
Ophiocordyceps australis map64 (Brazil) OphauB2|2539
Ophiocordyceps camponoti-floridani Ophcf2|04313
Ophiocordyceps camponoti-rufipedis Ophun1|4957
Ophiocordyceps kimflemingae Ophio5|1154 (this protein)
Ophiocordyceps subramaniannii Hirsu2|11057

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1154
MTRGVAAGPPTPSGSPLGRTRGNTWSFSKVEDTKICVVMVGLPARGKSYIAQIAQRYLQWLSIPAQTFNVGNYRR
NDAPQPPADFFDTNNAEGERKRRAAAEAAVADMLSWFRAGGVVGILDATNSTKERRKWVSDACAAHGIEVLFVES
KCDDEDIIMANIRDVKTTSPDYRGRDPDDAALDFRNRIRNYEKIYKTLDQDGDEDEYTYLKIMDVGKQVIINRIQ
DYLQSRIVYYLMNLHIRPRSVWLSRHGESLYNLDGRIGGDTLLSPRGELYARKLPELVRESVGDDRPLTVWTSTL
KRTIATARFLPPYYNQLQWKALDELDSGVCDGLTYQEIQDRYPEDFEARDEDKYNYRYRGGESYRDVVIRLEPII
MELERSEDILIVTHQAVLRCIYAYFMKKDQAKSPWMNVPLHTLIKLTPRAYGTEEVRYEANIPAVSTWRGKGSTA
KHENPTGETL
Coding >Ophio5|1154
ATGACGAGGGGAGTCGCGGCCGGGCCGCCCACGCCGTCGGGGTCGCCTCTGGGCCGTACCAGGGGCAACACCTGG
AGCTTCAGCAAGGTCGAAGACACCAAGATCTGCGTCGTCATGGTTGGCCTTCCGGCCCGAGGAAAGAGCTATATT
GCCCAGATAGCCCAGCGTTACCTCCAGTGGCTCTCCATCCCCGCCCAGACCTTCAACGTCGGCAATTACCGCCGT
AACGACGCGCCTCAGCCCCCTGCCGACTTCTTCGACACAAACAATGCCGAGGGTGAGCGCAAGCGCCGCGCCGCC
GCAGAGGCCGCCGTTGCGGATATGCTCTCGTGGTTCCGAGCCGGCGGCGTCGTCGGCATCCTCGACGCCACAAAC
TCGACCAAGGAGCGTCGGAAATGGGTTTCTGACGCCTGCGCCGCCCACGGCATCGAGGTGCTCTTCGTCGAGAGC
AAGTGCGACGACGAGGACATCATCATGGCCAACATCCGCGACGTCAAGACCACCAGCCCTGACTACCGCGGTCGC
GATCCCGACGACGCCGCTCTTGACTTTCGTAATCGCATCCGCAACTACGAGAAGATCTACAAGACGCTTGATCAG
GATGGCGACGAGGACGAGTACACCTATCTAAAGATTATGGACGTTGGCAAGCAGGTCATCATCAACCGCATCCAA
GACTATCTCCAGAGCCGCATCGTTTATTACCTGATGAATCTGCATATCCGCCCGCGCTCCGTCTGGCTCTCAAGG
CACGGAGAGTCTCTGTACAATCTCGACGGCAGGATCGGCGGCGATACACTACTATCACCACGCGGCGAGCTCTAC
GCCCGCAAGCTCCCCGAGCTCGTGCGCGAGTCCGTAGGCGACGATCGGCCCCTCACCGTTTGGACGTCGACGCTC
AAGCGCACCATCGCGACGGCCCGTTTCCTCCCCCCTTACTACAATCAGCTGCAGTGGAAGGCCCTGGACGAGCTC
GATTCGGGCGTCTGCGACGGCCTGACGTACCAGGAAATCCAGGACCGCTACCCCGAAGACTTCGAGGCGCGCGAC
GAGGACAAGTACAATTATCGCTATCGCGGGGGCGAGTCGTACCGCGATGTCGTCATCCGCCTCGAGCCCATCATC
ATGGAGCTCGAACGCAGCGAGGACATACTTATCGTGACGCACCAGGCGGTGCTGCGCTGCATTTACGCCTACTTT
ATGAAGAAGGACCAGGCTAAGAGCCCCTGGATGAATGTGCCGCTGCACACGCTCATCAAGCTGACGCCCAGGGCC
TATGGGACCGAAGAGGTGCGATACGAGGCCAACATCCCGGCCGTCAGCACCTGGCGCGGCAAGGGGAGCACGGCT
AAGCACGAAAACCCCACGGGCGAGACTCTG
Transcript >Ophio5|1154
ATGACGAGGGGAGTCGCGGCCGGGCCGCCCACGCCGTCGGGGTCGCCTCTGGGCCGTACCAGGGGCAACACCTGG
AGCTTCAGCAAGGTCGAAGACACCAAGATCTGCGTCGTCATGGTTGGCCTTCCGGCCCGAGGAAAGAGCTATATT
GCCCAGATAGCCCAGCGTTACCTCCAGTGGCTCTCCATCCCCGCCCAGACCTTCAACGTCGGCAATTACCGCCGT
AACGACGCGCCTCAGCCCCCTGCCGACTTCTTCGACACAAACAATGCCGAGGGTGAGCGCAAGCGCCGCGCCGCC
GCAGAGGCCGCCGTTGCGGATATGCTCTCGTGGTTCCGAGCCGGCGGCGTCGTCGGCATCCTCGACGCCACAAAC
TCGACCAAGGAGCGTCGGAAATGGGTTTCTGACGCCTGCGCCGCCCACGGCATCGAGGTGCTCTTCGTCGAGAGC
AAGTGCGACGACGAGGACATCATCATGGCCAACATCCGCGACGTCAAGACCACCAGCCCTGACTACCGCGGTCGC
GATCCCGACGACGCCGCTCTTGACTTTCGTAATCGCATCCGCAACTACGAGAAGATCTACAAGACGCTTGATCAG
GATGGCGACGAGGACGAGTACACCTATCTAAAGATTATGGACGTTGGCAAGCAGGTCATCATCAACCGCATCCAA
GACTATCTCCAGAGCCGCATCGTTTATTACCTGATGAATCTGCATATCCGCCCGCGCTCCGTCTGGCTCTCAAGG
CACGGAGAGTCTCTGTACAATCTCGACGGCAGGATCGGCGGCGATACACTACTATCACCACGCGGCGAGCTCTAC
GCCCGCAAGCTCCCCGAGCTCGTGCGCGAGTCCGTAGGCGACGATCGGCCCCTCACCGTTTGGACGTCGACGCTC
AAGCGCACCATCGCGACGGCCCGTTTCCTCCCCCCTTACTACAATCAGCTGCAGTGGAAGGCCCTGGACGAGCTC
GATTCGGGCGTCTGCGACGGCCTGACGTACCAGGAAATCCAGGACCGCTACCCCGAAGACTTCGAGGCGCGCGAC
GAGGACAAGTACAATTATCGCTATCGCGGGGGCGAGTCGTACCGCGATGTCGTCATCCGCCTCGAGCCCATCATC
ATGGAGCTCGAACGCAGCGAGGACATACTTATCGTGACGCACCAGGCGGTGCTGCGCTGCATTTACGCCTACTTT
ATGAAGAAGGACCAGGCTAAGAGCCCCTGGATGAATGTGCCGCTGCACACGCTCATCAAGCTGACGCCCAGGGCC
TATGGGACCGAAGAGGTGCGATACGAGGCCAACATCCCGGCCGTCAGCACCTGGCGCGGCAAGGGGAGCACGGCT
AAGCACGAAAACCCCACGGGCGAGACTCTGTGA
Gene >Ophio5|1154
ATGACGAGGGGAGTCGCGGCCGGGCCGCCCACGCCGTCGGGGTCGCCTCTGGGCCGTACCAGGGGCAACACCTGG
AGCTTCAGCAAGGTGAGGCTCACGAGAGATAATGTTCAATCCAATGATGGGATGGGTACTCTTCCACAGTTGCTA
CCGGGGTCGGTGCCTCGGCGCATTACCTCCTCTGCCAAGGCCGCAGCTATCCATCCCATGCACATGCAATCCATG
ATGCTTTCTGAACAGCCAGGCTGTGTACGTGCCACTACTGTACATGCACTACAGTGGCTGCACACCCCGCTGCTA
GGCCCGTCAGTAGCCATCGGCTTAGCGCCCGTTGGTGGCTTCTCCCTACCCACCTCCCCCCCCCCNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTC
TCTCTCTCTCTCTGTCTTCCCTCCGTCTCCTCTTCTTCTGCCTCTTGTCTCTCTCCCTCTCTCGGTCCGCTAATA
ATCCCGACCTCGCCTGCTCTTCCCGATGCCCTCGTTCCTCCTCGCCCGGCTTTCCGTCCTCGTCCGCACCTCGTT
CCGCCCCAGCCCCTGCATCGAACTCGTCCCTTTTCAACTGTTGATGCTTGCGCCGAATGCCTTGGCCTCTGAGCA
CTGTCATCTGTCGAGATGCCGTCCAAGACTGACAACGGCATCGGCGTCCAGGTCGAAGACACCAAGATCTGCGTC
GTCATGGTTGGCCTTCCGGCCCGAGGAAAGAGCTATATTGCCCAGATAGGTGTGTGACGAAGGCCTTCTTCCGGC
AGCCACCCGCATTTGCACGCTCTCCCTGGTCTCCCTCATTTTGCTCTCACACTCTGCTCTCACACTCTCCCCTCA
CCCTCACCCTCATCCCCCCCCCCCCCCCCCTTTTTTTTTCCTCGTCAGATTACTGACACACGTTCCCCTCTTTCC
TTAGCCCAGCGTTACCTCCAGTGGCTCTCCATCCCCGCCCAGACCTTCAACGTCGGCAATTACCGCCGTAACGAC
GCGCCTCAGCCCCCTGCCGACTTCTTCGACACAAACAATGCCGAGGGTGAGCGCAAGCGCCGCGCCGCCGCAGAG
GCCGCCGTTGCGGATATGCTCTCGTGGTTCCGAGCCGGCGGCGTCGTCGGCATCCTCGACGCCACAAACTCGACC
AAGGAGCGTCGGAAATGGGTTTCTGACGCCTGCGCCGCCCACGGCATCGAGGTGCTCTTCGTCGAGAGCAAGTGC
GACGACGAGGACATCATCATGGCCAACATCCGCGACGTCAAGACCACCAGCCCTGACTACCGCGGTCGCGATCCC
GACGACGCCGCTCTTGACTTTCGTAATCGCATCCGCAACTACGAGAAGATCTACAAGACGCTTGATCAGGATGGC
GACGAGGACGAGTACACCTATCTAAAGATTATGGACGTTGGCAAGCAGGTCATCATCAACCGCATCCAAGACTAT
CTCCAGAGCCGCATCGTTTATTACCTGATGAATCTGCATATCCGCCCGCGCTCCGTCTGGCTCTCAAGGGTGTGT
CCTCCTTCCCCCCCCCCCCCCGTTTCCCACTTCCCATGGCTCACGAATCGCCTCCAGCACGGAGAGTCTCTGTAC
AATCTCGACGGCAGGATCGGCGGCGATACACTACTATCACCACGCGGCGAGCTCTACGCCCGCAAGCTCCCCGAG
CTCGTGCGCGAGTCCGTAGGCGTACGTCTCCCTTCCCATTCGCCTCTACCCTCTTGTCTGTTGCAGCCTGCTGAT
TCTCTCTCGGCAGGACGATCGGCCCCTCACCGTTTGGACGTCGACGCTCAAGCGCACCATCGCGACGGCCCGTTT
CCTCCCCCCTTACTACAATCAGCTGCAGTGGAAGGCCCTGGACGAGCTCGATTCGGGCGTCTGCGACGGCCTGAC
GTACCAGGAAATCCAGGACCGCTACCCCGAAGACTTCGAGGCGCGCGACGAGGACAAGTACAATTATCGCTATCG
CGGGGGCGAGTCGTACCGCGATGTCGTCATCCGCCTCGAGCCCATCATCATGGAGCTCGAACGCAGCGAGGACAT
ACTTATCGTGACGCACCAGGCGGTGCTGCGCTGCATTTACGCCTACTTTATGAAGAAGGACCAGGCTAAGAGCCC
CTGGATGAATGTGCCGCTGCACACGCTCATCAAGCTGACGCCCAGGGCCTATGGGACCGAAGAGGTGCGATACGA
GGCCAACATCCCGGCCGTCAGCACCTGGCGCGGCAAGGGGAGCACGGCTAAGCACGAAAACCCCACGGGCGAGAC
TCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail