Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1151
Gene name
Locationscaffold_1365:166..2002
Strand-
Gene length (bp)1836
Transcript length (bp)1836
Coding sequence length (bp)1833
Protein length (aa) 611

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04734 Ceramidase_alk Neutral/alkaline non-lysosomal ceramidase, N-terminal 2.2E-195 103 610

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NR71|ASAH2_HUMAN Neutral ceramidase OS=Homo sapiens GN=ASAH2 PE=1 SV=2 52 610 8.0E-101
sp|Q304B9|NCASE_ARATH Neutral ceramidase OS=Arabidopsis thaliana GN=At2g38010 PE=3 SV=1 103 610 1.0E-100
sp|Q91XT9|ASAH2_RAT Neutral ceramidase OS=Rattus norvegicus GN=Asah2 PE=1 SV=1 103 610 2.0E-98
sp|Q9JHE3|ASAH2_MOUSE Neutral ceramidase OS=Mus musculus GN=Asah2 PE=1 SV=1 103 610 2.0E-97
sp|Q5W7F1|ASAH2_DANRE Neutral ceramidase OS=Danio rerio GN=asah2 PE=1 SV=1 92 610 2.0E-94
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NR71|ASAH2_HUMAN Neutral ceramidase OS=Homo sapiens GN=ASAH2 PE=1 SV=2 52 610 8.0E-101
sp|Q304B9|NCASE_ARATH Neutral ceramidase OS=Arabidopsis thaliana GN=At2g38010 PE=3 SV=1 103 610 1.0E-100
sp|Q91XT9|ASAH2_RAT Neutral ceramidase OS=Rattus norvegicus GN=Asah2 PE=1 SV=1 103 610 2.0E-98
sp|Q9JHE3|ASAH2_MOUSE Neutral ceramidase OS=Mus musculus GN=Asah2 PE=1 SV=1 103 610 2.0E-97
sp|Q5W7F1|ASAH2_DANRE Neutral ceramidase OS=Danio rerio GN=asah2 PE=1 SV=1 92 610 2.0E-94
sp|Q55G11|NCSEB_DICDI Neutral ceramidase B OS=Dictyostelium discoideum GN=dcd2B PE=3 SV=1 100 610 2.0E-91
sp|Q29C43|NCASE_DROPS Neutral ceramidase OS=Drosophila pseudoobscura pseudoobscura GN=CDase PE=3 SV=1 96 610 3.0E-91
sp|Q9VA70|NCASE_DROME Neutral ceramidase OS=Drosophila melanogaster GN=CDase PE=1 SV=1 96 610 6.0E-91
sp|Q54BK2|NCSEA_DICDI Neutral ceramidase A OS=Dictyostelium discoideum GN=dcd2A PE=1 SV=1 100 610 5.0E-90
sp|Q9I596|NCASE_PSEAE Neutral ceramidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0845 PE=1 SV=1 96 610 1.0E-72
sp|O06769|NCASE_MYCTU Neutral ceramidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0669c PE=1 SV=1 105 610 5.0E-50
sp|Q0JL46|NCASE_ORYSJ Neutral ceramidase OS=Oryza sativa subsp. japonica GN=Os01g0624000 PE=1 SV=1 103 338 1.0E-48
sp|Q0JL46|NCASE_ORYSJ Neutral ceramidase OS=Oryza sativa subsp. japonica GN=Os01g0624000 PE=1 SV=1 332 610 3.0E-39
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1151
MMMASGLGAAANGGGAGDEAVLRRRRYRPYWAILVVVASAACLALFRASGWTGAPPLLSSSPLHQAAGIADAESR
AGAEADGEKTWAGLRLPEATAGARDGLYLLGVGKADITGPVVELNMMGYADFNQIGSGLRQRLYSRAFIVGDVAE
PKDRFVYLVLDIQSGDTAIRYGILRGLQALGPRYSMYGHDNVAVTATHSHSGPGAWLNYLLPQIPSKGFDRQSFR
AIVEGCVLSIRRAHESLEPGHLTFGSTKVLGAGINRSLFSYLANPESERARYNISVHDDGSVETDMTMLSFRRAS
DRRNIGLLTWFPTHGTSMQANNTLISGDNKGVAADMLEKKLRTESDSFVAGFSQANMGDVSPNVLGGWCEDGSGE
ACRFEDSTCGDGRPSRCRAKGPGLGTDDHGASSCLEIGRRQYQAALDLYRNLDRTEAANVRGEGVKAFHRFHDMA
GFTFRLPNGSEAVTCAAALGYSFGAGTWDEPGSWDLVQHLSAKSKSSVLWRVISWLIRHPTVDQRRCQEPKSILL
DVGDKGLPYAWTPNVVDIQTLRVGQLLVIVSPGEATTMAGRRWKRAVADEARKTLVAELEGREPLVVLGAPSNSY
THYITTEEEYG
Coding >Ophio5|1151
ATGATGATGGCGTCAGGCCTAGGCGCAGCAGCAAATGGTGGTGGCGCCGGTGATGAGGCAGTCCTTCGACGGCGC
CGGTATCGGCCTTACTGGGCCATCTTGGTCGTTGTCGCCTCTGCCGCCTGTTTGGCCTTGTTCCGCGCGTCCGGC
TGGACCGGCGCCCCGCCGTTGTTGTCGTCATCGCCTCTCCACCAGGCTGCCGGTATCGCCGACGCCGAGAGCCGG
GCCGGAGCCGAAGCCGACGGGGAGAAGACCTGGGCCGGACTGCGTCTTCCGGAGGCGACCGCCGGGGCGAGGGAC
GGCCTTTACCTGCTGGGCGTCGGCAAGGCCGACATCACGGGCCCGGTGGTGGAGCTCAACATGATGGGATACGCA
GACTTTAACCAGATCGGCAGTGGCCTGCGTCAGCGGCTGTATTCGCGCGCCTTCATCGTCGGCGACGTTGCCGAG
CCCAAGGATCGCTTCGTCTACCTCGTTCTCGACATCCAGTCGGGCGACACCGCCATCCGCTACGGCATCCTTCGC
GGCCTGCAAGCCCTCGGCCCGCGATACTCCATGTACGGACATGACAACGTGGCGGTGACGGCGACGCACTCTCAT
TCCGGTCCCGGCGCCTGGCTCAACTACCTGCTACCGCAGATCCCGAGCAAGGGCTTCGACAGGCAGAGCTTCCGC
GCCATCGTCGAGGGCTGCGTGCTGTCCATCCGTCGCGCCCACGAGAGCCTCGAGCCCGGTCATCTGACGTTTGGC
TCGACCAAAGTGCTGGGCGCCGGCATCAACCGCAGCCTCTTCTCCTACCTCGCCAACCCGGAGTCGGAGCGGGCG
CGGTACAACATCAGCGTCCACGACGACGGCTCCGTCGAGACGGACATGACGATGCTGAGCTTTCGGCGAGCCTCG
GACCGGCGCAACATTGGCCTGCTGACTTGGTTTCCCACGCACGGCACCTCGATGCAGGCCAACAACACGCTCATC
TCGGGCGACAACAAGGGCGTGGCGGCGGACATGCTGGAGAAGAAGTTGCGGACCGAGTCCGACTCCTTCGTTGCC
GGCTTCTCGCAGGCCAACATGGGCGACGTCAGCCCCAACGTCCTGGGCGGATGGTGCGAGGACGGCTCGGGCGAG
GCGTGTCGCTTCGAAGACAGCACCTGTGGCGACGGACGGCCGAGCCGTTGCCGGGCAAAGGGTCCCGGCCTGGGC
ACGGACGACCACGGGGCCTCGTCCTGTCTCGAGATCGGACGGCGGCAGTATCAGGCGGCGCTGGACCTGTACCGG
AACCTGGACCGGACCGAGGCCGCCAACGTACGCGGCGAGGGCGTCAAAGCCTTCCACCGCTTCCACGACATGGCC
GGCTTCACCTTCCGGCTGCCCAACGGGTCCGAGGCCGTCACCTGCGCCGCCGCCCTGGGCTACTCGTTCGGCGCG
GGGACGTGGGACGAGCCGGGCTCGTGGGACCTGGTGCAGCACCTGTCGGCCAAGTCCAAGTCGTCGGTGCTATGG
CGCGTCATCAGCTGGTTGATCCGGCATCCGACGGTGGACCAGAGGCGCTGTCAGGAGCCCAAGTCGATCCTGCTC
GACGTGGGCGACAAGGGTCTGCCGTACGCGTGGACGCCCAACGTGGTGGACATACAGACGCTTCGCGTCGGCCAG
CTGCTCGTCATCGTCAGCCCCGGCGAGGCCACCACCATGGCGGGTAGGCGCTGGAAGCGGGCCGTGGCCGACGAG
GCCAGGAAGACGCTGGTCGCCGAGCTCGAGGGGAGGGAGCCGCTGGTTGTGCTGGGGGCACCGAGTAACAGCTAC
ACGCATTACATTACGACGGAGGAGGAGTATGGG
Transcript >Ophio5|1151
ATGATGATGGCGTCAGGCCTAGGCGCAGCAGCAAATGGTGGTGGCGCCGGTGATGAGGCAGTCCTTCGACGGCGC
CGGTATCGGCCTTACTGGGCCATCTTGGTCGTTGTCGCCTCTGCCGCCTGTTTGGCCTTGTTCCGCGCGTCCGGC
TGGACCGGCGCCCCGCCGTTGTTGTCGTCATCGCCTCTCCACCAGGCTGCCGGTATCGCCGACGCCGAGAGCCGG
GCCGGAGCCGAAGCCGACGGGGAGAAGACCTGGGCCGGACTGCGTCTTCCGGAGGCGACCGCCGGGGCGAGGGAC
GGCCTTTACCTGCTGGGCGTCGGCAAGGCCGACATCACGGGCCCGGTGGTGGAGCTCAACATGATGGGATACGCA
GACTTTAACCAGATCGGCAGTGGCCTGCGTCAGCGGCTGTATTCGCGCGCCTTCATCGTCGGCGACGTTGCCGAG
CCCAAGGATCGCTTCGTCTACCTCGTTCTCGACATCCAGTCGGGCGACACCGCCATCCGCTACGGCATCCTTCGC
GGCCTGCAAGCCCTCGGCCCGCGATACTCCATGTACGGACATGACAACGTGGCGGTGACGGCGACGCACTCTCAT
TCCGGTCCCGGCGCCTGGCTCAACTACCTGCTACCGCAGATCCCGAGCAAGGGCTTCGACAGGCAGAGCTTCCGC
GCCATCGTCGAGGGCTGCGTGCTGTCCATCCGTCGCGCCCACGAGAGCCTCGAGCCCGGTCATCTGACGTTTGGC
TCGACCAAAGTGCTGGGCGCCGGCATCAACCGCAGCCTCTTCTCCTACCTCGCCAACCCGGAGTCGGAGCGGGCG
CGGTACAACATCAGCGTCCACGACGACGGCTCCGTCGAGACGGACATGACGATGCTGAGCTTTCGGCGAGCCTCG
GACCGGCGCAACATTGGCCTGCTGACTTGGTTTCCCACGCACGGCACCTCGATGCAGGCCAACAACACGCTCATC
TCGGGCGACAACAAGGGCGTGGCGGCGGACATGCTGGAGAAGAAGTTGCGGACCGAGTCCGACTCCTTCGTTGCC
GGCTTCTCGCAGGCCAACATGGGCGACGTCAGCCCCAACGTCCTGGGCGGATGGTGCGAGGACGGCTCGGGCGAG
GCGTGTCGCTTCGAAGACAGCACCTGTGGCGACGGACGGCCGAGCCGTTGCCGGGCAAAGGGTCCCGGCCTGGGC
ACGGACGACCACGGGGCCTCGTCCTGTCTCGAGATCGGACGGCGGCAGTATCAGGCGGCGCTGGACCTGTACCGG
AACCTGGACCGGACCGAGGCCGCCAACGTACGCGGCGAGGGCGTCAAAGCCTTCCACCGCTTCCACGACATGGCC
GGCTTCACCTTCCGGCTGCCCAACGGGTCCGAGGCCGTCACCTGCGCCGCCGCCCTGGGCTACTCGTTCGGCGCG
GGGACGTGGGACGAGCCGGGCTCGTGGGACCTGGTGCAGCACCTGTCGGCCAAGTCCAAGTCGTCGGTGCTATGG
CGCGTCATCAGCTGGTTGATCCGGCATCCGACGGTGGACCAGAGGCGCTGTCAGGAGCCCAAGTCGATCCTGCTC
GACGTGGGCGACAAGGGTCTGCCGTACGCGTGGACGCCCAACGTGGTGGACATACAGACGCTTCGCGTCGGCCAG
CTGCTCGTCATCGTCAGCCCCGGCGAGGCCACCACCATGGCGGGTAGGCGCTGGAAGCGGGCCGTGGCCGACGAG
GCCAGGAAGACGCTGGTCGCCGAGCTCGAGGGGAGGGAGCCGCTGGTTGTGCTGGGGGCACCGAGTAACAGCTAC
ACGCATTACATTACGACGGAGGAGGAGTATGGGTGA
Gene >Ophio5|1151
ATGATGATGGCGTCAGGCCTAGGCGCAGCAGCAAATGGTGGTGGCGCCGGTGATGAGGCAGTCCTTCGACGGCGC
CGGTATCGGCCTTACTGGGCCATCTTGGTCGTTGTCGCCTCTGCCGCCTGTTTGGCCTTGTTCCGCGCGTCCGGC
TGGACCGGCGCCCCGCCGTTGTTGTCGTCATCGCCTCTCCACCAGGCTGCCGGTATCGCCGACGCCGAGAGCCGG
GCCGGAGCCGAAGCCGACGGGGAGAAGACCTGGGCCGGACTGCGTCTTCCGGAGGCGACCGCCGGGGCGAGGGAC
GGCCTTTACCTGCTGGGCGTCGGCAAGGCCGACATCACGGGCCCGGTGGTGGAGCTCAACATGATGGGATACGCA
GACTTTAACCAGATCGGCAGTGGCCTGCGTCAGCGGCTGTATTCGCGCGCCTTCATCGTCGGCGACGTTGCCGAG
CCCAAGGATCGCTTCGTCTACCTCGTTCTCGACATCCAGTCGGGCGACACCGCCATCCGCTACGGCATCCTTCGC
GGCCTGCAAGCCCTCGGCCCGCGATACTCCATGTACGGACATGACAACGTGGCGGTGACGGCGACGCACTCTCAT
TCCGGTCCCGGCGCCTGGCTCAACTACCTGCTACCGCAGATCCCGAGCAAGGGCTTCGACAGGCAGAGCTTCCGC
GCCATCGTCGAGGGCTGCGTGCTGTCCATCCGTCGCGCCCACGAGAGCCTCGAGCCCGGTCATCTGACGTTTGGC
TCGACCAAAGTGCTGGGCGCCGGCATCAACCGCAGCCTCTTCTCCTACCTCGCCAACCCGGAGTCGGAGCGGGCG
CGGTACAACATCAGCGTCCACGACGACGGCTCCGTCGAGACGGACATGACGATGCTGAGCTTTCGGCGAGCCTCG
GACCGGCGCAACATTGGCCTGCTGACTTGGTTTCCCACGCACGGCACCTCGATGCAGGCCAACAACACGCTCATC
TCGGGCGACAACAAGGGCGTGGCGGCGGACATGCTGGAGAAGAAGTTGCGGACCGAGTCCGACTCCTTCGTTGCC
GGCTTCTCGCAGGCCAACATGGGCGACGTCAGCCCCAACGTCCTGGGCGGATGGTGCGAGGACGGCTCGGGCGAG
GCGTGTCGCTTCGAAGACAGCACCTGTGGCGACGGACGGCCGAGCCGTTGCCGGGCAAAGGGTCCCGGCCTGGGC
ACGGACGACCACGGGGCCTCGTCCTGTCTCGAGATCGGACGGCGGCAGTATCAGGCGGCGCTGGACCTGTACCGG
AACCTGGACCGGACCGAGGCCGCCAACGTACGCGGCGAGGGCGTCAAAGCCTTCCACCGCTTCCACGACATGGCC
GGCTTCACCTTCCGGCTGCCCAACGGGTCCGAGGCCGTCACCTGCGCCGCCGCCCTGGGCTACTCGTTCGGCGCG
GGGACGTGGGACGAGCCGGGCTCGTGGGACCTGGTGCAGCACCTGTCGGCCAAGTCCAAGTCGTCGGTGCTATGG
CGCGTCATCAGCTGGTTGATCCGGCATCCGACGGTGGACCAGAGGCGCTGTCAGGAGCCCAAGTCGATCCTGCTC
GACGTGGGCGACAAGGGTCTGCCGTACGCGTGGACGCCCAACGTGGTGGACATACAGACGCTTCGCGTCGGCCAG
CTGCTCGTCATCGTCAGCCCCGGCGAGGCCACCACCATGGCGGGTAGGCGCTGGAAGCGGGCCGTGGCCGACGAG
GCCAGGAAGACGCTGGTCGCCGAGCTCGAGGGGAGGGAGCCGCTGGTTGTGCTGGGGGCACCGAGTAACAGCTAC
ACGCATTACATTACGACGGAGGAGGAGTATGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail