Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1122
Gene name
Locationscaffold_135:17706..20223
Strand+
Gene length (bp)2517
Transcript length (bp)2265
Coding sequence length (bp)2262
Protein length (aa) 754

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12708 Pectate_lyase_3 Pectate lyase superfamily protein 7.0E-31 70 275
PF12708 Pectate_lyase_3 Pectate lyase superfamily protein 1.5E-07 394 448

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53626|E13B_TRIHA Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum GN=bgn13.1 PE=1 SV=1 18 753 0.0E+00
sp|P49426|EXG1_COCCA Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum GN=EXG1 PE=1 SV=1 57 731 8.0E-63
sp|D4B0V1|E13B_ARTBC Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02077 PE=1 SV=1 369 700 1.0E-46
sp|D4B0V1|E13B_ARTBC Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02077 PE=1 SV=1 15 256 1.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1122
MFRLASTVALFLSVAVATPTFSSHASEADLSRRDAATFWYPKMDHSGPHRGYASDLNEEYQVYRAVKAGDGAGIQ
KAINDDNGRQRHGQWLASQPRVVYIPSGTYELRKTLYMNTDTILMGDATDPPVLKAASGFSGTPILVSGQDPATG
ELGERSFAVGLKNLVLDTTNIPGGDAFTALYWGVAQGAQLQNMKIVMAETSGDNGHSGIHLGRGSTLGLSDVRIE
HGLNGIWHDGHQQAAYKNIQFYRNKVGMLISAGNTISIMGSTFDSCDAGVRNTGGTPWIAMIDCTSINSGVSFET
TGQPSFLIENFVKDSDSDMARGPEGTLLGPGRYVDRFFYGKTVYDPTTANSPRPPALAPGGQYPVIPAPTYADKA
VSDFINVKDARQNGGNKVYGDDSADDADALNKVLEYAAREGKIAYFPFGKYRVESTVVIPPGSRIVGEAWATISG
SGAYFKDETKPRPVLSVGRDGDVGLAQIQDMRFTVSDVLPGAIIVQFNMAGRLPGDVALWNSLVTVGGTRGASRL
AEGCGDAGNECKAAFLGMHFTSNSSAYVENVWNWVADHIIEDFEGGTSIAGKGGALVESTKATWLHALGSEHWWL
YQLNLRRARNVMVSLLQAETNYDQGEKTKQLVPAPWTPDVQGWGDPDFESCAEDDRRCRMGYATITDGGSDIYTY
ASAAWAFFSGPGYQGCGSQACQGTMHWITQTPRNLQAFGLCSKDADAVVRLADGSKVLMRPGFEGSWPGSGGLVG
RYTP
Coding >Ophio5|1122
ATGTTCCGGCTTGCATCGACCGTCGCTCTTTTCCTGTCTGTGGCTGTGGCTACGCCGACGTTTAGCAGCCATGCG
AGCGAGGCCGACTTGTCGAGGCGCGATGCTGCCACCTTTTGGTATCCGAAAATGGACCATTCCGGTCCTCATCGT
GGCTACGCTTCCGACTTGAACGAGGAGTATCAGGTCTATCGTGCCGTGAAAGCGGGCGATGGCGCTGGTATCCAA
AAGGCCATCAATGACGATAATGGACGTCAGCGTCATGGTCAATGGCTGGCTTCTCAGCCTAGAGTTGTCTACATC
CCGTCGGGCACGTATGAGCTTAGGAAGACGCTCTATATGAATACCGACACCATTTTGATGGGCGACGCCACAGAC
CCGCCGGTTCTGAAAGCGGCTTCTGGCTTCTCCGGCACCCCGATACTGGTTTCCGGTCAGGATCCGGCCACTGGG
GAACTCGGCGAGCGCTCCTTCGCCGTTGGTCTCAAAAACTTGGTGCTGGACACGACCAATATCCCTGGCGGTGAT
GCATTCACGGCGCTGTACTGGGGCGTCGCTCAGGGGGCGCAGCTGCAGAACATGAAGATCGTCATGGCTGAGACG
AGCGGCGACAACGGCCACAGCGGCATTCACCTAGGACGCGGCTCGACGTTGGGCCTGTCGGACGTGCGAATCGAA
CACGGTCTGAATGGCATCTGGCACGACGGCCACCAGCAGGCCGCCTACAAGAACATACAGTTCTACCGTAACAAG
GTGGGCATGCTCATCAGCGCCGGCAACACCATCAGCATCATGGGATCAACATTTGACTCTTGTGATGCCGGCGTC
CGCAACACGGGCGGCACCCCCTGGATCGCCATGATTGACTGCACGTCGATCAACTCGGGCGTCTCGTTCGAGACG
ACAGGCCAGCCGTCGTTCCTCATCGAGAACTTTGTAAAGGACAGCGACTCGGACATGGCGCGGGGCCCAGAGGGG
ACCTTGCTGGGACCCGGCCGCTATGTCGACCGCTTCTTCTACGGAAAGACGGTCTACGACCCAACGACGGCCAAC
AGTCCCCGGCCCCCGGCGCTGGCCCCCGGCGGCCAATACCCGGTGATTCCGGCGCCGACGTACGCGGACAAGGCT
GTGTCGGACTTTATCAACGTCAAGGATGCGAGGCAGAACGGCGGGAACAAGGTGTACGGCGATGACAGCGCTGAC
GACGCGGACGCCCTCAACAAGGTGCTGGAATACGCGGCGCGCGAGGGAAAAATCGCCTATTTCCCCTTTGGAAAG
TACCGGGTCGAGTCGACGGTGGTGATCCCGCCTGGCTCGCGCATTGTTGGCGAGGCCTGGGCTACCATCTCCGGT
AGCGGCGCTTACTTCAAGGATGAGACCAAGCCGCGGCCCGTGCTGTCTGTCGGTCGTGATGGCGACGTCGGCCTC
GCACAGATACAGGACATGCGCTTCACCGTCTCGGACGTGCTTCCTGGGGCCATCATCGTGCAGTTCAACATGGCG
GGCCGACTGCCCGGCGACGTGGCGCTATGGAACTCGCTCGTGACGGTCGGCGGCACACGGGGGGCTTCCAGGCTG
GCTGAGGGCTGTGGTGATGCGGGCAACGAGTGCAAAGCCGCCTTTCTCGGGATGCACTTCACTAGCAACTCGTCG
GCCTACGTGGAGAACGTGTGGAATTGGGTGGCGGATCACATCATCGAGGACTTTGAAGGCGGCACCAGCATCGCC
GGCAAAGGCGGCGCCCTCGTCGAGTCGACAAAGGCCACCTGGTTGCACGCCCTGGGCAGCGAGCACTGGTGGCTG
TATCAGCTCAACCTGCGGCGAGCGCGCAACGTCATGGTGTCGTTACTCCAAGCCGAGACGAACTACGACCAGGGC
GAGAAGACGAAGCAGCTTGTGCCGGCGCCGTGGACTCCCGACGTCCAAGGTTGGGGGGATCCGGACTTTGAATCG
TGCGCTGAGGACGACAGGCGTTGTCGTATGGGCTATGCTACCATCACGGATGGGGGTTCTGATATCTACACGTAT
GCCTCGGCAGCGTGGGCCTTTTTCAGCGGTCCGGGATACCAGGGATGTGGCAGCCAGGCGTGTCAAGGCACCATG
CACTGGATTACCCAGACGCCCAGAAATCTGCAGGCGTTTGGGCTGTGTTCCAAGGACGCCGACGCCGTGGTCCGT
TTGGCTGACGGGTCCAAAGTGCTGATGCGGCCAGGCTTCGAGGGGTCATGGCCTGGGAGTGGTGGGCTGGTGGGT
CGGTATACGCCT
Transcript >Ophio5|1122
ATGTTCCGGCTTGCATCGACCGTCGCTCTTTTCCTGTCTGTGGCTGTGGCTACGCCGACGTTTAGCAGCCATGCG
AGCGAGGCCGACTTGTCGAGGCGCGATGCTGCCACCTTTTGGTATCCGAAAATGGACCATTCCGGTCCTCATCGT
GGCTACGCTTCCGACTTGAACGAGGAGTATCAGGTCTATCGTGCCGTGAAAGCGGGCGATGGCGCTGGTATCCAA
AAGGCCATCAATGACGATAATGGACGTCAGCGTCATGGTCAATGGCTGGCTTCTCAGCCTAGAGTTGTCTACATC
CCGTCGGGCACGTATGAGCTTAGGAAGACGCTCTATATGAATACCGACACCATTTTGATGGGCGACGCCACAGAC
CCGCCGGTTCTGAAAGCGGCTTCTGGCTTCTCCGGCACCCCGATACTGGTTTCCGGTCAGGATCCGGCCACTGGG
GAACTCGGCGAGCGCTCCTTCGCCGTTGGTCTCAAAAACTTGGTGCTGGACACGACCAATATCCCTGGCGGTGAT
GCATTCACGGCGCTGTACTGGGGCGTCGCTCAGGGGGCGCAGCTGCAGAACATGAAGATCGTCATGGCTGAGACG
AGCGGCGACAACGGCCACAGCGGCATTCACCTAGGACGCGGCTCGACGTTGGGCCTGTCGGACGTGCGAATCGAA
CACGGTCTGAATGGCATCTGGCACGACGGCCACCAGCAGGCCGCCTACAAGAACATACAGTTCTACCGTAACAAG
GTGGGCATGCTCATCAGCGCCGGCAACACCATCAGCATCATGGGATCAACATTTGACTCTTGTGATGCCGGCGTC
CGCAACACGGGCGGCACCCCCTGGATCGCCATGATTGACTGCACGTCGATCAACTCGGGCGTCTCGTTCGAGACG
ACAGGCCAGCCGTCGTTCCTCATCGAGAACTTTGTAAAGGACAGCGACTCGGACATGGCGCGGGGCCCAGAGGGG
ACCTTGCTGGGACCCGGCCGCTATGTCGACCGCTTCTTCTACGGAAAGACGGTCTACGACCCAACGACGGCCAAC
AGTCCCCGGCCCCCGGCGCTGGCCCCCGGCGGCCAATACCCGGTGATTCCGGCGCCGACGTACGCGGACAAGGCT
GTGTCGGACTTTATCAACGTCAAGGATGCGAGGCAGAACGGCGGGAACAAGGTGTACGGCGATGACAGCGCTGAC
GACGCGGACGCCCTCAACAAGGTGCTGGAATACGCGGCGCGCGAGGGAAAAATCGCCTATTTCCCCTTTGGAAAG
TACCGGGTCGAGTCGACGGTGGTGATCCCGCCTGGCTCGCGCATTGTTGGCGAGGCCTGGGCTACCATCTCCGGT
AGCGGCGCTTACTTCAAGGATGAGACCAAGCCGCGGCCCGTGCTGTCTGTCGGTCGTGATGGCGACGTCGGCCTC
GCACAGATACAGGACATGCGCTTCACCGTCTCGGACGTGCTTCCTGGGGCCATCATCGTGCAGTTCAACATGGCG
GGCCGACTGCCCGGCGACGTGGCGCTATGGAACTCGCTCGTGACGGTCGGCGGCACACGGGGGGCTTCCAGGCTG
GCTGAGGGCTGTGGTGATGCGGGCAACGAGTGCAAAGCCGCCTTTCTCGGGATGCACTTCACTAGCAACTCGTCG
GCCTACGTGGAGAACGTGTGGAATTGGGTGGCGGATCACATCATCGAGGACTTTGAAGGCGGCACCAGCATCGCC
GGCAAAGGCGGCGCCCTCGTCGAGTCGACAAAGGCCACCTGGTTGCACGCCCTGGGCAGCGAGCACTGGTGGCTG
TATCAGCTCAACCTGCGGCGAGCGCGCAACGTCATGGTGTCGTTACTCCAAGCCGAGACGAACTACGACCAGGGC
GAGAAGACGAAGCAGCTTGTGCCGGCGCCGTGGACTCCCGACGTCCAAGGTTGGGGGGATCCGGACTTTGAATCG
TGCGCTGAGGACGACAGGCGTTGTCGTATGGGCTATGCTACCATCACGGATGGGGGTTCTGATATCTACACGTAT
GCCTCGGCAGCGTGGGCCTTTTTCAGCGGTCCGGGATACCAGGGATGTGGCAGCCAGGCGTGTCAAGGCACCATG
CACTGGATTACCCAGACGCCCAGAAATCTGCAGGCGTTTGGGCTGTGTTCCAAGGACGCCGACGCCGTGGTCCGT
TTGGCTGACGGGTCCAAAGTGCTGATGCGGCCAGGCTTCGAGGGGTCATGGCCTGGGAGTGGTGGGCTGGTGGGT
CGGTATACGCCTTAG
Gene >Ophio5|1122
ATGTTCCGGCTTGCATCGACCGTCGCTCTTTTCCTGTCTGTGGCTGTGGCTACGCCGACGTTTAGCAGCCATGCG
AGCGAGGCCGACTTGTCGAGGCGCGATGCTGCCACCTTTTGGTATCCGAAAATGGACCATTCCGGTCCTCATCGT
GGCTACGCTTCCGACTTGAACGAGGAGTATCAGGTCTATCGTGCCGTGAAAGCGGGCGATGGCGCTGGTATCCAA
AAGGCCATCAATGACGATAATGGACGTCAGCGTCATGGTCAATGGCTGGCTTCTCAGCCTAGAGTATGTCGAGTG
GTGGCTGTGATGAGTCTTCTAAGTTCTGATTGTGTGTTCGCAGGTTGTCTACATCCCGTCGGGCACGTATGAGCT
TAGGAAGACGCTCTATATGAATACCGACACCATTTTGATGGGCGACGCCACAGACGTACGTGACGGCTTCGTCTC
CTTTTCCTCATTCACTAGGCTGACCTGTCACATCCTGCAGCCGCCGGTTCTGAAAGCGGCTTCTGGCTTCTCCGG
CACCCCGATACTGGTTTCCGGTCAGGATCCGGCCACTGGGGAACTCGGCGAGCGCTCCTTCGCCGTTGGTCTCAA
AAACTTGGTGCTGGACACGACCAATATCCCTGGCGGTGCGTCTTGGTTACATACTGACTCGCCGTGACGAACATG
ATATCTGACGAATCGTCTAGGTGATGCATTCACGGCGCTGTACTGGGGCGTCGCTCAGGGGGCGCAGCTGCAGAA
CATGAAGATCGTCATGGCTGAGACGAGCGGCGACAACGGCCACAGCGGCATTCACCTAGGACGCGGCTCGACGTT
GGGCCTGTCGGACGTGCGAATCGAACACGGTCTGAATGGCATCTGGCACGACGGCCACCAGCAGGCCGCCTACAA
GAACATACAGTTCTACCGTAACAAGGTGGGCATGCTCATCAGCGCCGGCAACACCATCAGCATCATGGGATCAAC
ATTTGACTCTTGTGATGCCGGCGTCCGCAACACGGGCGGCACCCCCTGGATCGCCATGATTGACTGCACGTCGAT
CAACTCGGGCGTCTCGTTCGAGACGACAGGCCAGCCGTCGTTCCTCATCGAGAACTTTGTAAAGGACAGCGACTC
GGACATGGCGCGGGGCCCAGAGGGGACCTTGCTGGGACCCGGCCGCTATGTCGACCGCTTCTTCTACGGAAAGAC
GGTCTACGACCCAACGACGGCCAACAGTCCCCGGCCCCCGGCGCTGGCCCCCGGCGGCCAATACCCGGTGATTCC
GGCGCCGACGTACGCGGACAAGGCTGTGTCGGACTTTATCAACGTCAAGGATGCGAGGCAGAACGGCGGGAACAA
GGTGTACGGCGATGACAGCGCTGACGACGCGGACGCCCTCAACAAGGTGCTGGAATACGCGGCGCGCGAGGGAAA
AATCGCCTATTTCCCCTTTGGAAAGTACCGGGTCGAGTCGACGGTGGTGATCCCGCCTGGCTCGCGCATTGTTGG
CGAGGCCTGGGCTACCATCTCCGGTAGCGGCGCTTACTTCAAGGATGAGACCAAGCCGCGGCCCGTGCTGTCTGT
CGGTCGTGATGGCGACGTCGGCCTCGCACAGATACAGGACATGCGCTTCACCGTCTCGGACGTGCTTCCTGGGGC
CATCATCGTGCAGTTCAACATGGCGGGCCGACTGCCCGGCGACGTGGCGCTATGGAACTCGCTCGTGACGGTCGG
CGGCACACGGGGGGCTTCCAGGCTGGCTGAGGGCTGTGGTGATGCGGGCAACGAGTGCAAAGCCGCCTTTCTCGG
GATGCACTTCACTAGCAACTCGTCGGCCTACGTGGAGAACGTGTGGAATTGGGTGGCGGATCACATCATCGAGGA
CTTTGAAGGCGGCACCAGCATCGCCGGCAAAGGCGGCGCCCTCGTCGAGTCGACAAAGGCCACCTGGTTGCACGC
CCTGGGCAGCGAGCACTGGTGGCTGTATCAGCTCAACCTGCGGCGAGCGCGCAACGTCATGGTGTCGTTACTCCA
AGCCGAGACGAACTACGACCAGGGCGAGAAGACGAAGCAGCTTGTGCCGGCGCCGTGGACTCCCGACGTCCAAGG
TTGGGGGGATCCGGACTTTGAATCGTGCGCTGAGGACGACAGGCGTTGTCGTATGGGCTATGCTACCATCACGGA
TGGGGGTTCTGATATCTACACGTATGCCTCGGCAGCGTGGGCCTTTTTCAGCGGTCCGGGATACCAGGGATGTGG
CAGCCAGGCGTGTCAAGGTATTATTCCCCCCCCCCCCCCTTTTTTTGAGGCCACCAGGACAAAGGACGAGGAACG
ACGAGCTGACCAGGTACAGGCACCATGCACTGGATTACCCAGACGCCCAGAAATCTGCAGGCGTTTGGGCTGTGT
TCCAAGGACGCCGACGCCGTGGTCCGTTTGGCTGACGGGTCCAAAGTGCTGATGCGGCCAGGCTTCGAGGGGTCA
TGGCCTGGGAGTGGTGGGCTGGTGGGTCGGTATACGCCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail