Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1108
Gene name
Locationscaffold_134:35031..36148
Strand-
Gene length (bp)1117
Transcript length (bp)1023
Coding sequence length (bp)1020
Protein length (aa) 340

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10000 ACT_3 ACT domain 9.5E-16 150 218
PF13551 HTH_29 Winged helix-turn helix 4.1E-09 26 77
PF13840 ACT_7 ACT domain 2.2E-06 217 273
PF13518 HTH_28 Helix-turn-helix domain 1.9E-06 26 76
PF13384 HTH_23 Homeodomain-like domain 3.1E-06 24 64

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 220 242 22
2 303 325 22

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Homeodomain-like HTH
Helix-turn-helix

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1108
MESSNLEASSAIGDRKPKGEITPEARAAIIAAVQAGERKSVIAARFRISPAAIDRTLQRFEKTGQLVSRPRSGRP
KSNKGRGTAVAVAATPPPPPPPPPPPPPPPPPPPPPPPPPPSQKQTPPPSEPSTERLLGPVRNSRCPSAAVPSAA
EAPLSKLLATLTTMLHPATFVFISLSPVSPLPPLSEMQLLFREPDGITIVVSIDFAAAQKMQYFFPCRMITLNVT
TGLDAVGFMAVIASRLAARNMGVNPVSGFYHDHLFVPLGREDEALEVLAAVAEEHRREIGQIRHGLRHSRARVYS
RSAASVFGSCICTLFILHGMALPALSPFISPSCLHSKAAR
Coding >Ophio5|1108
ATGGAATCGTCCAACCTGGAGGCCTCGTCCGCCATTGGCGATCGAAAGCCAAAGGGTGAAATCACGCCAGAGGCT
CGAGCCGCCATCATCGCTGCTGTGCAGGCGGGTGAGCGCAAGAGCGTCATTGCCGCTCGCTTTCGAATCTCGCCT
GCTGCCATCGACCGGACGCTGCAGCGGTTCGAGAAGACAGGTCAACTGGTTTCGCGGCCAAGGTCGGGAAGGCCA
AAGTCTAACAAGGGTCGTGGCACGGCTGTTGCTGTTGCTGCCACTCCTCCCCCTCCTCCCCCTCCTCCTCCTCCT
CCTCCTCCCCCACCACCACCACCACCACCTCCACCTCCGCCTCCTCCTTCTCAGAAACAAACACCGCCGCCTTCG
GAGCCGTCGACTGAGCGCCTCCTCGGCCCTGTTCGAAATTCTCGCTGTCCATCGGCCGCCGTGCCGTCTGCTGCC
GAAGCGCCCTTGTCGAAGCTGCTGGCGACGCTTACGACGATGCTACATCCCGCCACCTTCGTTTTCATCAGCCTT
AGCCCCGTCTCGCCACTTCCGCCTCTGTCTGAGATGCAACTGTTGTTCCGCGAGCCAGACGGAATCACCATCGTC
GTGAGCATCGACTTTGCCGCCGCCCAGAAGATGCAATACTTCTTCCCCTGCCGCATGATCACGCTCAATGTCACC
ACCGGCCTCGACGCCGTTGGATTCATGGCTGTCATAGCTTCCAGACTCGCCGCGCGAAACATGGGCGTCAACCCC
GTCAGCGGCTTCTACCACGATCACCTGTTTGTGCCACTCGGCCGAGAGGACGAGGCACTCGAGGTGCTGGCCGCC
GTGGCCGAGGAGCACAGGCGAGAGATCGGTCAGATTCGGCACGGTCTGCGCCATTCGCGTGCGCGCGTATATTCC
CGATCTGCCGCCTCCGTCTTCGGTTCATGTATCTGTACCCTTTTCATCTTGCATGGCATGGCACTCCCGGCTCTC
TCACCGTTTATTTCTCCATCTTGTTTGCACAGCAAAGCAGCCCGA
Transcript >Ophio5|1108
ATGGAATCGTCCAACCTGGAGGCCTCGTCCGCCATTGGCGATCGAAAGCCAAAGGGTGAAATCACGCCAGAGGCT
CGAGCCGCCATCATCGCTGCTGTGCAGGCGGGTGAGCGCAAGAGCGTCATTGCCGCTCGCTTTCGAATCTCGCCT
GCTGCCATCGACCGGACGCTGCAGCGGTTCGAGAAGACAGGTCAACTGGTTTCGCGGCCAAGGTCGGGAAGGCCA
AAGTCTAACAAGGGTCGTGGCACGGCTGTTGCTGTTGCTGCCACTCCTCCCCCTCCTCCCCCTCCTCCTCCTCCT
CCTCCTCCCCCACCACCACCACCACCACCTCCACCTCCGCCTCCTCCTTCTCAGAAACAAACACCGCCGCCTTCG
GAGCCGTCGACTGAGCGCCTCCTCGGCCCTGTTCGAAATTCTCGCTGTCCATCGGCCGCCGTGCCGTCTGCTGCC
GAAGCGCCCTTGTCGAAGCTGCTGGCGACGCTTACGACGATGCTACATCCCGCCACCTTCGTTTTCATCAGCCTT
AGCCCCGTCTCGCCACTTCCGCCTCTGTCTGAGATGCAACTGTTGTTCCGCGAGCCAGACGGAATCACCATCGTC
GTGAGCATCGACTTTGCCGCCGCCCAGAAGATGCAATACTTCTTCCCCTGCCGCATGATCACGCTCAATGTCACC
ACCGGCCTCGACGCCGTTGGATTCATGGCTGTCATAGCTTCCAGACTCGCCGCGCGAAACATGGGCGTCAACCCC
GTCAGCGGCTTCTACCACGATCACCTGTTTGTGCCACTCGGCCGAGAGGACGAGGCACTCGAGGTGCTGGCCGCC
GTGGCCGAGGAGCACAGGCGAGAGATCGGTCAGATTCGGCACGGTCTGCGCCATTCGCGTGCGCGCGTATATTCC
CGATCTGCCGCCTCCGTCTTCGGTTCATGTATCTGTACCCTTTTCATCTTGCATGGCATGGCACTCCCGGCTCTC
TCACCGTTTATTTCTCCATCTTGTTTGCACAGCAAAGCAGCCCGATGA
Gene >Ophio5|1108
ATGGAATCGTCCAACCTGGAGGCCTCGTCCGCCATTGGCGATCGAAAGCCAAAGGGTGAAATCACGCCAGAGGCT
CGAGCCGCCATCATCGCTGCTGTGCAGGCGGGTGAGCGCAAGAGCGTCATTGCCGCTCGCTTTCGAATCTCGCCT
GCTGCCATCGACCGGACGCTGCAGCGGTTCGAGAAGACAGGTCAACTGGTTTCGCGGCCAAGGTCGGGAAGGCCA
AAGTCTAACAAGGGTCGTGGCACGGCTGTTGCTGTTGCTGCCACTCCTCCCCCTCCTCCCCCTCCTCCTCCTCCT
CCTCCTCCCCCACCACCACCACCACCACCTCCACCTCCGCCTCCTCCTTCTCAGAAACAAACACCGCCGCCTTCG
GAGCCGTCGACTGAGCGCCTCCTCGGCCCTGTTCGAAATTCTCGCTGTCCATCGGCCGCCGTGCCGTCTGCTGCC
GAAGCGCCCTTGTCGAAGCTGCTGGCGACGCTTACGACGATGCTACATCCCGCCACCTTCGTTTTCATCAGCCTT
AGCCCCGTCTCGCCACTTCCGCCTCTGTCTGAGATGCAACTGTTGTTCCGCGAGCCAGACGGAATCACCATCGTC
GTGAGCATCGACTTTGCCGCCGCCCAGAAGATGCAATACTTCTTCCCCTGCCGCATGATCACGCTCAATGTCACC
ACCGGCCTCGACGCCGTTGGATTCATGGCTGTCATAGCTTCCAGACTCGCCGCGCGAAACATGGGCGTCAACCCC
GTCAGCGGCTTCTACCACGATCACCTGTTTGTGCCACTCGGCCGAGAGGACGAGGCACTCGAGGTGCTGGCCGCC
GTGGCCGAGGAGCACAGGCGAGAGATCGGTCAGATTCGGCAGTAACCATCCAAATGCAGCCATCGGCTTCCTCCA
CTTGCTCAGCGGTCTGCGCCATTCGCGTGCGCGCGTATGTCGGTACCCCTCGGTGTGACGGCGAGTGTAATCTGC
TGATGTCCATGTAGATTCCCGATCTGCCGCCTCCGTCTTCGGTTCATGTATCTGTACCCTTTTCATCTTGCATGG
CATGGCACTCCCGGCTCTCTCACCGTTTATTTCTCCATCTTGTTTGCACAGCAAAGCAGCCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail