Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1107
Gene name
Locationscaffold_134:32984..34592
Strand-
Gene length (bp)1608
Transcript length (bp)1455
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.3E-27 12 345
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 3.4E-07 14 44
PF00890 FAD_binding_2 FAD binding domain 8.8E-05 12 42

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 10 395 6.0E-23
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 10 395 3.0E-21
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 10 374 2.0E-19
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 10 374 5.0E-19
sp|P9WM51|Y1260_MYCTU Uncharacterized protein Rv1260 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1260 PE=1 SV=1 13 372 9.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 10 395 6.0E-23
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 10 395 3.0E-21
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 10 374 2.0E-19
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 10 374 5.0E-19
sp|P9WM51|Y1260_MYCTU Uncharacterized protein Rv1260 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1260 PE=1 SV=1 13 372 9.0E-12
sp|P9WM50|Y1260_MYCTO Uncharacterized protein MT1298 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1298 PE=4 SV=1 13 372 9.0E-12
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 13 340 3.0E-10
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 32 394 6.0E-10
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 48 375 8.0E-10
sp|Q93NG3|DHPH_ARTNI 2,6-dihydroxypyridine 3-monooxygenase OS=Arthrobacter nicotinovorans GN=dhpH PE=1 SV=1 11 340 4.0E-09
sp|O07561|YHJG_BACSU Uncharacterized aromatic compound monooxygenase YhjG OS=Bacillus subtilis (strain 168) GN=yhjG PE=3 SV=1 9 336 8.0E-09
sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 9 351 7.0E-08
sp|A0R1T4|MHPA_MYCS2 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mhpA PE=3 SV=2 5 336 2.0E-07
sp|B5B0J6|HPXO_KLEOX FAD-dependent urate hydroxylase OS=Klebsiella oxytoca GN=hpxO PE=3 SV=1 10 343 4.0E-07
sp|Q01911|TETX_BACFG Tetracycline resistance protein from transposon Tn4351/Tn4400 OS=Bacteroides fragilis GN=tetX PE=4 SV=1 14 172 3.0E-06
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 9 185 4.0E-06
sp|A0QB57|MHPA_MYCA1 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium avium (strain 104) GN=mhpA PE=3 SV=1 1 336 4.0E-06
sp|Q742Z1|MHPA_MYCPA 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mhpA PE=3 SV=1 1 336 4.0E-06
sp|A4T8B6|MHPA_MYCGI 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium gilvum (strain PYR-GCK) GN=mhpA PE=3 SV=1 13 336 8.0E-06
sp|D4B1Y1|A2462_ARTBC Probable FAD-dependent monooxygenase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02462 PE=3 SV=1 6 184 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 458 480 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 44.07 23.76 64.38
CcL In ants, during behavior modification 10.71 4.10 17.32
CcD In ants, recently dead 5.23 1.50 8.95

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.031066 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1107
MVAPESSARLRAIIVGAGIGGLTTAHALHRAGIDYVVVEKHDDVLKPFGSTITLHPGQLRILHQLGLLDRLKTLA
RPYNRGGEFRDSDGRLLSKFDLSSMRIKHGEAGMLMNRESLIKILYEALPDKSKVLTGRLIVAIAHEADSVQVQL
SDGLSETGHLIIGADGVHSVVRSAMWEHADATNPGLIPPEDKKVVGCKWKLIWASGPEDPRLSNDVTVGSFPGRR
CSIVLSQPGIATFIMIWKTSEAGPRSSQRRKYTAEDAEELMASIARLPVNESVTFGDLWKNRFRQGMSDTQVGVM
KRWHHGRIVLVGDATFSITPTTGLGANMCIENVAALVNALHEAVVEATRQGRGRPTGSDLEAAFHKYRDRQWPRT
LYSYRFANFFDRLYSWDTPWMRFWACCVARTLSMVLLPKLLSDHARGVPVLKFVDLVGWPEGRIRWEHGEEEKGG
GGGGRGGALAWMLLAVVVLLGAVGLAFVMGGGGI
Coding >Ophio5|1107
ATGGTCGCTCCAGAATCAAGCGCTCGGCTCCGTGCCATCATCGTGGGCGCCGGCATTGGCGGCCTGACGACGGCT
CACGCACTGCACCGGGCCGGTATTGACTACGTCGTCGTGGAGAAGCACGATGATGTGCTCAAGCCTTTCGGGTCA
ACCATTACTCTGCACCCCGGGCAACTGAGGATCCTACATCAGCTGGGGCTCCTGGACAGGCTCAAGACCCTCGCA
CGTCCCTATAACCGAGGCGGTGAATTTCGAGACTCAGACGGGCGGCTGCTCTCCAAATTTGACCTATCCTCCATG
CGCATCAAACATGGGGAAGCCGGTATGCTTATGAACCGCGAATCCCTCATCAAGATTCTCTACGAGGCGCTGCCC
GACAAGTCCAAGGTTCTCACGGGCAGGCTCATTGTGGCCATTGCACATGAAGCGGATAGCGTGCAGGTCCAATTA
TCAGACGGCCTCTCCGAGACGGGCCATCTGATCATTGGAGCAGACGGCGTACACAGCGTCGTGCGAAGCGCAATG
TGGGAGCATGCGGATGCCACAAATCCGGGGCTGATACCCCCAGAGGACAAGAAGGTGGTGGGGTGTAAATGGAAG
CTCATTTGGGCCTCGGGCCCGGAAGACCCACGGCTGAGCAATGATGTCACCGTCGGCAGTTTTCCCGGCCGGCGC
TGCTCAATCGTTCTTTCGCAGCCGGGAATCGCGACCTTCATCATGATATGGAAGACGAGCGAGGCGGGACCGCGC
AGCAGCCAGCGGCGCAAGTACACGGCTGAGGACGCCGAGGAACTTATGGCGTCGATTGCTCGTCTGCCCGTTAAC
GAGAGTGTGACGTTTGGCGATCTGTGGAAGAATAGGTTTCGACAGGGAATGTCGGACACTCAGGTTGGCGTTATG
AAACGCTGGCACCACGGACGCATCGTCCTTGTCGGCGATGCAACCTTCAGCATAACACCGACCACCGGCCTCGGC
GCCAACATGTGCATCGAGAACGTCGCCGCCCTCGTCAACGCCCTCCACGAAGCCGTAGTCGAGGCAACAAGGCAG
GGACGAGGCCGCCCTACCGGCTCCGACCTCGAGGCCGCTTTCCACAAGTATCGAGATCGCCAATGGCCGCGTACG
CTCTACTCGTACCGCTTCGCCAACTTTTTCGACCGTCTGTATTCATGGGATACGCCGTGGATGAGGTTCTGGGCT
TGTTGTGTGGCTCGTACGTTGTCCATGGTCTTGTTGCCCAAACTGCTTAGCGACCATGCCCGCGGGGTCCCCGTC
TTGAAATTTGTCGACCTGGTCGGCTGGCCCGAGGGGAGGATTCGCTGGGAGCATGGGGAGGAGGAAAAGGGAGGA
GGCGGAGGAGGACGAGGAGGCGCTCTGGCTTGGATGCTCTTGGCCGTTGTTGTGCTGCTTGGTGCTGTGGGGTTG
GCTTTTGTTATGGGCGGTGGTGGCATT
Transcript >Ophio5|1107
ATGGTCGCTCCAGAATCAAGCGCTCGGCTCCGTGCCATCATCGTGGGCGCCGGCATTGGCGGCCTGACGACGGCT
CACGCACTGCACCGGGCCGGTATTGACTACGTCGTCGTGGAGAAGCACGATGATGTGCTCAAGCCTTTCGGGTCA
ACCATTACTCTGCACCCCGGGCAACTGAGGATCCTACATCAGCTGGGGCTCCTGGACAGGCTCAAGACCCTCGCA
CGTCCCTATAACCGAGGCGGTGAATTTCGAGACTCAGACGGGCGGCTGCTCTCCAAATTTGACCTATCCTCCATG
CGCATCAAACATGGGGAAGCCGGTATGCTTATGAACCGCGAATCCCTCATCAAGATTCTCTACGAGGCGCTGCCC
GACAAGTCCAAGGTTCTCACGGGCAGGCTCATTGTGGCCATTGCACATGAAGCGGATAGCGTGCAGGTCCAATTA
TCAGACGGCCTCTCCGAGACGGGCCATCTGATCATTGGAGCAGACGGCGTACACAGCGTCGTGCGAAGCGCAATG
TGGGAGCATGCGGATGCCACAAATCCGGGGCTGATACCCCCAGAGGACAAGAAGGTGGTGGGGTGTAAATGGAAG
CTCATTTGGGCCTCGGGCCCGGAAGACCCACGGCTGAGCAATGATGTCACCGTCGGCAGTTTTCCCGGCCGGCGC
TGCTCAATCGTTCTTTCGCAGCCGGGAATCGCGACCTTCATCATGATATGGAAGACGAGCGAGGCGGGACCGCGC
AGCAGCCAGCGGCGCAAGTACACGGCTGAGGACGCCGAGGAACTTATGGCGTCGATTGCTCGTCTGCCCGTTAAC
GAGAGTGTGACGTTTGGCGATCTGTGGAAGAATAGGTTTCGACAGGGAATGTCGGACACTCAGGTTGGCGTTATG
AAACGCTGGCACCACGGACGCATCGTCCTTGTCGGCGATGCAACCTTCAGCATAACACCGACCACCGGCCTCGGC
GCCAACATGTGCATCGAGAACGTCGCCGCCCTCGTCAACGCCCTCCACGAAGCCGTAGTCGAGGCAACAAGGCAG
GGACGAGGCCGCCCTACCGGCTCCGACCTCGAGGCCGCTTTCCACAAGTATCGAGATCGCCAATGGCCGCGTACG
CTCTACTCGTACCGCTTCGCCAACTTTTTCGACCGTCTGTATTCATGGGATACGCCGTGGATGAGGTTCTGGGCT
TGTTGTGTGGCTCGTACGTTGTCCATGGTCTTGTTGCCCAAACTGCTTAGCGACCATGCCCGCGGGGTCCCCGTC
TTGAAATTTGTCGACCTGGTCGGCTGGCCCGAGGGGAGGATTCGCTGGGAGCATGGGGAGGAGGAAAAGGGAGGA
GGCGGAGGAGGACGAGGAGGCGCTCTGGCTTGGATGCTCTTGGCCGTTGTTGTGCTGCTTGGTGCTGTGGGGTTG
GCTTTTGTTATGGGCGGTGGTGGCATTTAG
Gene >Ophio5|1107
ATGGTCGCTCCAGAATCAAGCGCTCGGCTCCGTGCCATCATCGTGGGCGCCGGCATTGGCGGCCTGACGACGGCT
CACGCACTGCACCGGGCCGGTATTGACTACGTCGTCGTGGAGAAGCACGATGATGTGCTCAAGCCTTTCGGGTCA
ACCATTACTCTGCACCCCGGGCAACTGAGGATCCTACATCAGCTGGGGCTCCTGGACAGGCTCAAGACCCTCGCA
CGTCCCTATAACCGAGGCGGTGAATTTCGAGACTCAGACGGGCGGCTGCTCTCCAAATTTGACCTATCCTCCATG
CGCATCAAGTAAGCGTGCCCATGCTCGCCCTTTTATACGCTGTGCTCTGACGAAGCCCGCCAGACATGGGGAAGC
CGGTATGCTTATGAACCGCGAATCCCTCATCAAGATTCTCTACGAGGCGCTGCCCGACAAGTCCAAGGTTCTCAC
GGGCAGGCTCATTGTGGCCATTGCACATGAAGCGGATAGCGTGCAGGTCCAATTATCAGACGGCCTCTCCGAGAC
GGGCCATCTGATCATTGGAGCAGACGGCGTACACAGCGTCGTGCGAAGCGCAATGTGGGAGCATGCGGATGCCAC
AAATCCGGGGCTGATACCCCCAGAGGACAAGAAGGGTAAAGACTTTCCGTCTTGGATTTTCGATGCGAGGCTCAC
TGCTCACAGTGGTGGGGTGTAAATGGAAGCTCATTTGGGCCTCGGGCCCGGAAGACCCACGGCTGAGCAATGATG
TCACCGTCGGCAGTTTTCCCGGCCGGCGCTGCTCAATCGTTCTTTCGCAGCCGGGAATCGCGACCTTCATCATGA
TATGGAAGACGAGCGAGGCGGGACCGCGCAGCAGCCAGCGGCGCAAGTACACGGCTGAGGACGCCGAGGAACTTA
TGGCGTCGATTGCTCGTCTGCCCGTTAACGAGAGTGTGACGTTTGGCGATCTGTGGAAGAATAGGTTTCGACAGG
GAATGTCGGACACTCAGGTTGGCGTTATGAAACGCTGGCACCACGGACGCATCGTCCTTGTCGGCGATGCAACCT
TCAGCGTAGGCATCATCTCCTCCAGACGCTGTCCATCTGACACTCAGCGATCAGATAACACCGACCACCGGCCTC
GGCGCCAACATGTGCATCGAGAACGTCGCCGCCCTCGTCAACGCCCTCCACGAAGCCGTAGTCGAGGCAACAAGG
CAGGGACGAGGCCGCCCTACCGGCTCCGACCTCGAGGCCGCTTTCCACAAGTATCGAGATCGCCAATGGCCGCGT
ACGCTCTACTCGTACCGCTTCGCCAACTTTTTCGACCGTCTGTATTCATGGGATACGCCGTGGATGAGGTTCTGG
GCTTGTTGTGTGGCTCGTACGTTGTCCATGGTCTTGTTGCCCAAACTGCTTAGCGACCATGCCCGCGGGGTCCCC
GTCTTGAAATTTGTCGACCTGGTCGGCTGGCCCGAGGGGAGGATTCGCTGGGAGCATGGGGAGGAGGAAAAGGGA
GGAGGCGGAGGAGGACGAGGAGGCGCTCTGGCTTGGATGCTCTTGGCCGTTGTTGTGCTGCTTGGTGCTGTGGGG
TTGGCTTTTGTTATGGGCGGTGGTGGCATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail