Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1106
Gene name
Locationscaffold_134:30203..32196
Strand-
Gene length (bp)1993
Transcript length (bp)1665
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 5 375 5.0E-11
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 21 359 2.0E-10
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 31 389 7.0E-10
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 21 328 4.0E-09
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 118 386 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 5 375 5.0E-11
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 21 359 2.0E-10
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 31 389 7.0E-10
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 21 328 4.0E-09
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 118 386 5.0E-08
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 118 386 5.0E-08
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 20 533 7.0E-08
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 54 476 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.5

Transmembrane Domains

Domain # Start End Length
1 37 59 22
2 74 96 22
3 103 125 22
4 129 151 22
5 163 185 22
6 189 211 22
7 224 246 22
8 256 278 22
9 299 321 22
10 336 354 18
11 361 383 22
12 407 429 22
13 448 470 22
14 521 543 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1106
MALVNNNDETSLHIIPLDVIEDRAEDEVILPPWGLKLFMLNAGVVVVCFLHALDTVIPVHLQTVMGDQLGYAEAL
PWISAGMGAFALALPIGKLYVIGNKRAVFIFCYINYLCGVAICGGTPTMTGAIVGRVWAAIGSTGMRIGLFYLVE
GVMPRGNRSVYQIASVFSWAVAFALGSFIGMLGSSWRWAFYTQLIVSIGVLPPMIMRLPPGPARTAVNEHLDTVG
TMFSSVPIVLFTIASVYAGIVDHWMGPTVVLLFTIGGILTLAFMLQQVSDIFATAQERHLNVSQLRNREPALRFA
LVGLSTVVAWIVIFYYPFYLYAIRGGSPTETARDLLTFVIALIVALISMGVIHHKPGYYRCLYIFAVAVGVIGCV
FMSLPLFVSPPHSKPRLTDRIQGRMGAEDSKAGVYACGLMLGVTAGCIIHAGLAAYQPESDPGGVTPSISMKLLS
HLAGSWFGACVGGAIYMTTAKAGLRALFPDLSAEARDSLVLGTAGHFLADLGPTDRKLALELLAGGLKKVWYPAM
VASGLSVVLAMLVQVCLLARLVVEGDVVG
Coding >Ophio5|1106
ATGGCGCTCGTCAACAATAACGATGAAACCTCTCTCCATATAATTCCTTTGGATGTCATCGAAGACAGGGCTGAA
GACGAGGTTATTCTCCCGCCTTGGGGTCTCAAGCTCTTCATGCTCAACGCGGGCGTTGTCGTTGTCTGCTTCCTA
CATGCCTTGGATACGGTTATCCCTGTTCATCTTCAGACGGTCATGGGCGATCAGCTTGGTTACGCCGAGGCACTT
CCTTGGATCTCTGCTGGAATGGGTGCTTTTGCCCTCGCGCTCCCCATCGGAAAACTCTACGTCATCGGAAACAAG
CGGGCGGTTTTCATCTTCTGCTACATCAACTACCTATGCGGAGTCGCCATCTGCGGCGGAACACCTACCATGACG
GGCGCCATTGTTGGACGCGTTTGGGCTGCCATCGGAAGCACTGGGATGCGTATTGGCTTGTTCTACCTCGTTGAG
GGAGTCATGCCCCGCGGCAACCGCTCTGTTTACCAGATTGCCTCCGTCTTTTCCTGGGCTGTCGCCTTTGCTCTT
GGTTCTTTCATCGGCATGCTTGGCTCGTCGTGGCGCTGGGCCTTCTACACGCAGTTGATCGTCAGCATCGGTGTT
CTCCCGCCCATGATCATGAGGCTTCCCCCCGGTCCGGCCAGAACGGCGGTGAATGAACATCTAGACACTGTCGGC
ACCATGTTCAGTTCAGTCCCCATTGTCCTCTTCACCATCGCTAGCGTCTACGCAGGCATCGTCGATCACTGGATG
GGTCCGACCGTCGTCCTCCTCTTCACCATCGGCGGTATCCTCACCCTGGCTTTCATGCTACAGCAAGTTTCGGAC
ATCTTTGCCACCGCCCAAGAGCGTCACCTGAACGTCAGCCAGCTTCGCAACCGAGAGCCTGCCTTGCGTTTCGCC
CTTGTCGGATTAAGCACCGTCGTGGCTTGGATTGTCATCTTCTACTACCCCTTCTACCTCTACGCCATCAGAGGA
GGCTCTCCGACGGAGACGGCTCGCGATCTGCTGACCTTTGTCATTGCCCTCATCGTCGCTCTCATTTCCATGGGC
GTCATTCATCACAAGCCGGGATATTATCGCTGCCTTTACATCTTTGCCGTGGCTGTTGGCGTCATTGGCTGTGTC
TTTATGAGTCTGCCTCTCTTTGTTTCCCCTCCCCATAGTAAGCCCCGACTGACGGATAGAATCCAAGGTCGGATG
GGCGCCGAAGATTCCAAGGCGGGCGTATACGCCTGCGGACTGATGCTGGGCGTCACGGCCGGGTGCATCATCCAC
GCCGGCCTCGCCGCATACCAGCCTGAAAGCGACCCAGGCGGCGTGACGCCCAGCATCTCCATGAAGCTGCTCAGC
CACCTGGCCGGCTCATGGTTCGGCGCCTGCGTGGGGGGCGCCATCTACATGACGACGGCCAAGGCAGGCCTAAGG
GCCTTGTTCCCGGATCTGAGCGCCGAAGCTCGCGACTCCCTGGTACTCGGGACCGCCGGACACTTCCTCGCGGAT
TTGGGACCAACGGACCGAAAGTTGGCCCTGGAACTTCTCGCTGGCGGGTTGAAGAAGGTGTGGTACCCGGCCATG
GTCGCGTCTGGCTTGTCCGTTGTGCTGGCTATGCTGGTTCAGGTATGTTTGCTTGCGCGTCTTGTGGTAGAAGGA
GATGTTGTGGGC
Transcript >Ophio5|1106
ATGGCGCTCGTCAACAATAACGATGAAACCTCTCTCCATATAATTCCTTTGGATGTCATCGAAGACAGGGCTGAA
GACGAGGTTATTCTCCCGCCTTGGGGTCTCAAGCTCTTCATGCTCAACGCGGGCGTTGTCGTTGTCTGCTTCCTA
CATGCCTTGGATACGGTTATCCCTGTTCATCTTCAGACGGTCATGGGCGATCAGCTTGGTTACGCCGAGGCACTT
CCTTGGATCTCTGCTGGAATGGGTGCTTTTGCCCTCGCGCTCCCCATCGGAAAACTCTACGTCATCGGAAACAAG
CGGGCGGTTTTCATCTTCTGCTACATCAACTACCTATGCGGAGTCGCCATCTGCGGCGGAACACCTACCATGACG
GGCGCCATTGTTGGACGCGTTTGGGCTGCCATCGGAAGCACTGGGATGCGTATTGGCTTGTTCTACCTCGTTGAG
GGAGTCATGCCCCGCGGCAACCGCTCTGTTTACCAGATTGCCTCCGTCTTTTCCTGGGCTGTCGCCTTTGCTCTT
GGTTCTTTCATCGGCATGCTTGGCTCGTCGTGGCGCTGGGCCTTCTACACGCAGTTGATCGTCAGCATCGGTGTT
CTCCCGCCCATGATCATGAGGCTTCCCCCCGGTCCGGCCAGAACGGCGGTGAATGAACATCTAGACACTGTCGGC
ACCATGTTCAGTTCAGTCCCCATTGTCCTCTTCACCATCGCTAGCGTCTACGCAGGCATCGTCGATCACTGGATG
GGTCCGACCGTCGTCCTCCTCTTCACCATCGGCGGTATCCTCACCCTGGCTTTCATGCTACAGCAAGTTTCGGAC
ATCTTTGCCACCGCCCAAGAGCGTCACCTGAACGTCAGCCAGCTTCGCAACCGAGAGCCTGCCTTGCGTTTCGCC
CTTGTCGGATTAAGCACCGTCGTGGCTTGGATTGTCATCTTCTACTACCCCTTCTACCTCTACGCCATCAGAGGA
GGCTCTCCGACGGAGACGGCTCGCGATCTGCTGACCTTTGTCATTGCCCTCATCGTCGCTCTCATTTCCATGGGC
GTCATTCATCACAAGCCGGGATATTATCGCTGCCTTTACATCTTTGCCGTGGCTGTTGGCGTCATTGGCTGTGTC
TTTATGAGTCTGCCTCTCTTTGTTTCCCCTCCCCATAGTAAGCCCCGACTGACGGATAGAATCCAAGGTCGGATG
GGCGCCGAAGATTCCAAGGCGGGCGTATACGCCTGCGGACTGATGCTGGGCGTCACGGCCGGGTGCATCATCCAC
GCCGGCCTCGCCGCATACCAGCCTGAAAGCGACCCAGGCGGCGTGACGCCCAGCATCTCCATGAAGCTGCTCAGC
CACCTGGCCGGCTCATGGTTCGGCGCCTGCGTGGGGGGCGCCATCTACATGACGACGGCCAAGGCAGGCCTAAGG
GCCTTGTTCCCGGATCTGAGCGCCGAAGCTCGCGACTCCCTGGTACTCGGGACCGCCGGACACTTCCTCGCGGAT
TTGGGACCAACGGACCGAAAGTTGGCCCTGGAACTTCTCGCTGGCGGGTTGAAGAAGGTGTGGTACCCGGCCATG
GTCGCGTCTGGCTTGTCCGTTGTGCTGGCTATGCTGGTTCAGGTATGTTTGCTTGCGCGTCTTGTGGTAGAAGGA
GATGTTGTGGGCTAA
Gene >Ophio5|1106
ATGGCGCTCGTCAACAATAACGATGAAACCTCTCTCCATATAATTCCTTTGGATGTCATCGAAGACAGGGCTGAA
GACGAGGTTATTCTCCCGCCTTGGGGTCTCAAGGTTTGTGGCTTGCCCCCAAAAAACGCGAGAGGGGAGAAAAAC
AAATGAGGCTGACGAGAATGCATAGCTCTTCATGCTCAACGCGGGCGTTGTCGTTGTCTGCTTCCTACATGCCTT
GGATACGGTTATCCCTGTTCATCTTCAGACGGTTCGTTTTGTCTCCTCTTTCTCCTCTCTTTCTTCCTTCTTCCT
ACCTGCTTCCTGACGCCGAGCTTTAGGTCATGGGCGATCAGCTTGGTTACGCCGAGGCACTTCCTTGGATCTCTG
CTGGGTATTTCAAGAGCTTCGCCAGCCAGCGAGCCACATAACCACGTTGTGAAATTTTTTTTTCTTCGGTCATGC
TCACGGAATGATTCAAAAGATTTAGAATGGGTGCTTTTGCCCTCGCGCTCCCCATCGGAAAACTCTACGTCATCG
GAAACAAGCGGGCGGTTTTCATCTTCTGCTACATCAACTACCTATGCGGAGTCGCCATCTGCGGCGGAACACCTA
CCATGACGGGCGCCATTGTTGGACGCGTTTGGGCTGCCATCGGAAGCACTGGGATGCGTATTGGCTTGTTCTACC
TCGTTGAGGGAGTCATGCCCCGCGGCAACCGCTCTGTTTACCAGATTGCCTCGTGAGTTTTTCCTTTTTTTTTAA
TCATCATTATTTGCCTACCTTGTCTGTTTATTTCACCGTTTCTTGCTTTTCTAAACGTGTCGTTGCAAACAGCGT
CTTTTCCTGGGCTGTCGCCTTTGCTCTTGGTTCTTTCATCGGCATGCTTGGCTCGTCGTGGCGCTGGGCCTTCTA
CACGCAGTTGATCGTCAGCATCGGTGTTCTCCCGCCCATGATCATGAGGCTTCCCCCCGGTCCGGCCAGAACGGC
GGTGAATGAACATCTAGACACTGTCGGCACCATGTTCAGTTCAGTCCCCATTGTCCTCTTCACCATCGCTAGCGT
CTACGCAGGCATCGTCGATCACTGGATGGGTCCGACCGTCGTCCTCCTCTTCACCATCGGCGGTATCCTCACCCT
GGCTTTCATGCTACAGCAAGTTTCGGACATCTTTGCCACCGCCCAAGAGCGTCACCTGAACGTCAGCCAGCTTCG
CAACCGAGAGCCTGCCTTGCGTTTCGCCCTTGTCGGATTAAGCACCGTCGTGGCTTGGATTGTCATCTTCTACTA
CCCCTTCTACCTCTACGCCATCAGAGGAGGCTCTCCGACGGAGACGGCTCGCGATCTGCTGACCTTTGTCATTGC
CCTCATCGTCGCTCTCATTTCCATGGGCGTCATTCATCACAAGCCGGGATATTATCGCTGCCTTTACATCTTTGC
CGTGGCTGTTGGCGTCATTGGCTGTGTCTTTATGAGTCTGCCTCTCTTTGTTTCCCCTCCCCATAGTAAGCCCCG
ACTGACGGATAGAATCCAAGGTCGGATGGGCGCCGAAGATTCCAAGGCGGGCGTATACGCCTGCGGACTGATGCT
GGGCGTCACGGCCGGGTGCATCATCCACGCCGGCCTCGCCGCATACCAGCCTGAAAGCGACCCAGGCGGCGTGAC
GCCCAGCATCTCCATGAAGCTGCTCAGCCACCTGGCCGGCTCATGGTTCGGCGCCTGCGTGGGGGGCGCCATCTA
CATGACGACGGCCAAGGCAGGCCTAAGGGCCTTGTTCCCGGATCTGAGCGCCGAAGCTCGCGACTCCCTGGTACT
CGGGACCGCCGGACACTTCCTCGCGGATTTGGGACCAACGGACCGAAAGTTGGCCCTGGAACTTCTCGCTGGCGG
GTTGAAGAAGGTGTGGTACCCGGCCATGGTCGCGTCTGGCTTGTCCGTTGTGCTGGCTATGCTGGTTCAGGTATG
TTTGCTTGCGCGTCTTGTGGTAGAAGGAGATGTTGTGGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail