Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1103
Gene name
Locationscaffold_134:21555..23092
Strand-
Gene length (bp)1537
Transcript length (bp)1293
Coding sequence length (bp)1290
Protein length (aa) 430

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.6E-17 50 287
PF07690 MFS_1 Major Facilitator Superfamily 6.4E-09 279 423

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08280|BSC6_YEAST Bypass of stop codon protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BSC6 PE=1 SV=1 20 425 6.0E-35
sp|O07563|GLCP_BACSU Glucose/mannose transporter GlcP OS=Bacillus subtilis (strain 168) GN=glcP PE=1 SV=1 53 394 1.0E-06

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 75 97 22
3 110 127 17
4 137 159 22
5 168 190 22
6 200 219 19
7 252 274 22
8 284 306 22
9 311 333 22
10 337 359 22
11 372 394 22
12 404 423 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1103
MSDIHEPLLPPAPPGIGPVANDSRPSDHDDDQTERWNRPRGNIAKLAFASLSFALVGMNDASIGALIPYLEDYYG
ISYAYVSIIFLTPFVGYSVAAFTNAFVHQRLGQRGIAVVAPLCHVATYLVLANHPPYPVLVAANAISGFGNGLVD
ACFCAWVGVMHRGNSIQGLMHACYSLGALLSPLLATSMVIKAELPWYTFYYVMISVALVELVGLSFCFWDKSGAV
YRAQHASEHGESQGSTSEALKSPVTWLCAFFFFTYMGAEVGLGGWIVTFMLRVRHASPFAAGLSGSGFWAGMALG
RASLGFVTERFGERLCLTVYLVICIALELVFWLVPRFIVSAIAVILLGFFLGPMFPGGVMVTAKLLPRRIHVSAI
GFAMAMGGSGGTVFPFIIGAIAASQGVRVLQPIVLALIVLNLILWLSFPRINRRG
Coding >Ophio5|1103
ATGTCCGACATCCACGAGCCGTTACTGCCGCCGGCGCCCCCCGGAATCGGCCCCGTCGCCAACGACAGCCGACCG
TCGGATCATGACGACGACCAGACCGAGCGCTGGAATCGGCCAAGAGGCAACATCGCGAAGCTGGCCTTTGCCTCG
TTGTCGTTTGCCCTCGTCGGCATGAACGACGCCTCCATCGGCGCGCTGATCCCATACCTCGAAGATTACTACGGC
ATTAGCTACGCCTACGTGTCCATCATCTTCCTCACTCCCTTTGTTGGCTACTCTGTTGCCGCCTTCACCAACGCC
TTCGTTCATCAACGGCTTGGACAGCGCGGCATCGCCGTCGTGGCGCCGCTGTGTCATGTTGCAACTTACCTCGTG
CTCGCCAACCATCCGCCGTATCCGGTTCTAGTCGCCGCCAATGCCATCAGTGGCTTTGGAAATGGTCTGGTAGAC
GCCTGTTTCTGTGCCTGGGTCGGTGTCATGCACCGCGGCAACTCCATACAGGGTCTGATGCATGCCTGCTACTCG
CTCGGCGCTCTTCTTTCCCCTCTCCTGGCCACCTCCATGGTCATCAAGGCCGAGCTTCCGTGGTACACCTTTTAC
TATGTCATGATCAGCGTGGCCTTGGTAGAGCTGGTAGGCCTCAGCTTCTGCTTCTGGGACAAGTCGGGCGCCGTC
TATCGAGCGCAGCATGCCAGCGAGCACGGCGAATCCCAAGGCAGCACCTCGGAGGCTCTCAAGTCGCCCGTCACC
TGGCTATGTGCCTTTTTCTTCTTCACCTACATGGGCGCCGAAGTTGGCCTCGGCGGTTGGATCGTCACCTTCATG
CTGCGCGTCCGTCACGCCTCCCCCTTCGCCGCCGGCCTCTCCGGCTCCGGCTTCTGGGCCGGCATGGCACTCGGC
CGTGCCTCACTGGGCTTCGTGACGGAGCGCTTCGGCGAGCGGCTATGTCTCACGGTATACCTCGTCATCTGCATC
GCCCTCGAGCTGGTCTTCTGGCTGGTGCCGCGCTTCATCGTGTCCGCCATTGCCGTCATCCTCTTGGGCTTCTTC
CTCGGTCCCATGTTCCCCGGCGGCGTCATGGTGACGGCCAAGTTGCTTCCTCGGCGGATACACGTGAGCGCCATT
GGGTTTGCCATGGCTATGGGAGGCAGCGGCGGCACCGTCTTCCCCTTCATCATCGGCGCTATCGCTGCCAGTCAG
GGCGTCAGGGTGCTGCAGCCCATCGTCCTGGCTCTCATCGTGCTGAACTTGATCCTGTGGCTCAGCTTTCCGCGG
ATCAACAGGAGGGGT
Transcript >Ophio5|1103
ATGTCCGACATCCACGAGCCGTTACTGCCGCCGGCGCCCCCCGGAATCGGCCCCGTCGCCAACGACAGCCGACCG
TCGGATCATGACGACGACCAGACCGAGCGCTGGAATCGGCCAAGAGGCAACATCGCGAAGCTGGCCTTTGCCTCG
TTGTCGTTTGCCCTCGTCGGCATGAACGACGCCTCCATCGGCGCGCTGATCCCATACCTCGAAGATTACTACGGC
ATTAGCTACGCCTACGTGTCCATCATCTTCCTCACTCCCTTTGTTGGCTACTCTGTTGCCGCCTTCACCAACGCC
TTCGTTCATCAACGGCTTGGACAGCGCGGCATCGCCGTCGTGGCGCCGCTGTGTCATGTTGCAACTTACCTCGTG
CTCGCCAACCATCCGCCGTATCCGGTTCTAGTCGCCGCCAATGCCATCAGTGGCTTTGGAAATGGTCTGGTAGAC
GCCTGTTTCTGTGCCTGGGTCGGTGTCATGCACCGCGGCAACTCCATACAGGGTCTGATGCATGCCTGCTACTCG
CTCGGCGCTCTTCTTTCCCCTCTCCTGGCCACCTCCATGGTCATCAAGGCCGAGCTTCCGTGGTACACCTTTTAC
TATGTCATGATCAGCGTGGCCTTGGTAGAGCTGGTAGGCCTCAGCTTCTGCTTCTGGGACAAGTCGGGCGCCGTC
TATCGAGCGCAGCATGCCAGCGAGCACGGCGAATCCCAAGGCAGCACCTCGGAGGCTCTCAAGTCGCCCGTCACC
TGGCTATGTGCCTTTTTCTTCTTCACCTACATGGGCGCCGAAGTTGGCCTCGGCGGTTGGATCGTCACCTTCATG
CTGCGCGTCCGTCACGCCTCCCCCTTCGCCGCCGGCCTCTCCGGCTCCGGCTTCTGGGCCGGCATGGCACTCGGC
CGTGCCTCACTGGGCTTCGTGACGGAGCGCTTCGGCGAGCGGCTATGTCTCACGGTATACCTCGTCATCTGCATC
GCCCTCGAGCTGGTCTTCTGGCTGGTGCCGCGCTTCATCGTGTCCGCCATTGCCGTCATCCTCTTGGGCTTCTTC
CTCGGTCCCATGTTCCCCGGCGGCGTCATGGTGACGGCCAAGTTGCTTCCTCGGCGGATACACGTGAGCGCCATT
GGGTTTGCCATGGCTATGGGAGGCAGCGGCGGCACCGTCTTCCCCTTCATCATCGGCGCTATCGCTGCCAGTCAG
GGCGTCAGGGTGCTGCAGCCCATCGTCCTGGCTCTCATCGTGCTGAACTTGATCCTGTGGCTCAGCTTTCCGCGG
ATCAACAGGAGGGGTTGA
Gene >Ophio5|1103
ATGTCCGACATCCACGAGCCGTTACTGCCGCCGGCGCCCCCCGGAATCGGCCCCGTCGCCAACGACAGCCGACCG
TCGGATCATGACGACGACCAGACCGAGCGCTGGAATCGGCCAAGAGGCAACATCGCGAAGCTGGCCTTTGCCTCG
TTGTCGTTTGCCCTCGTCGGCATGAACGACGCCTCCATCGGCGTGCGGCCTCCCCCCCTTTCCGTTACCACGTCG
CTGTCCGGCTCTGACCATGTCTCGATAGGCGCTGATCCCATACGTACGGCCCCTCTCCCCTATGACGCTGATGGT
GATGTCTTGGCGTAGTCTGATAGGAGAGGCGCGATAGCTCGAAGATTACTACGGCATTAGCTACGCCTACGTGTC
CATCATCTTCCTCACTCCCTTTGTTGGCTACTCTGTTGCCGCCTTCACCAACGCCTTCGTTCATCAACGGCTTGG
ACAGCGCGGCATCGCCGTCGTGGCGCCGCTGTGTCATGTTGCAACTTACCTCGTGCTCGCCAACCATCCGCCGTA
TCCGGTTCTAGTCGCCGCCAATGCCATCAGTGGCTTTGGAAATGGTCTGGTAGACGCCTGTTTCTGTGCCTGGGT
CGGTGTCATGCACCGCGGCAACTCCATACAGGGTCTGATGCATGCCTGCTACTCGCTCGGCGCTCTTCTTTCCCC
TCTCCTGGCCACCTCCATGGTCATCAAGGCCGAGCTTCCGTGGTACACCTTTTACTATGTCATGGTGAGGCCGTC
GTCATCCTTGCGTCTAGGCTGCTATTGATGCTCGGCCCAGATCAGCGTGGCCTTGGTAGAGCTGGTAGGCCTCAG
CTTCTGCTTCTGGGACAAGTCGGGCGCCGTCTATCGAGCGCAGCATGCCAGCGAGCACGGCGAATCCCAAGGCAG
CACCTCGGAGGCTCTCAAGTCGCCCGTCACCTGGCTATGTGCCTTTTTCTTCTTCACCTACATGGGCGCCGAAGG
TATGCATCTATCCAATCATTCTCTCTAACCTCACACGCAGACCAACTGAACCTTTTTTAAAGTTGGCCTCGGCGG
TTGGATCGTCACCTTCATGCTGCGCGTCCGTCACGCCTCCCCCTTCGCCGCCGGCCTCTCCGGCTCCGGCTTCTG
GGCCGGCATGGCACTCGGCCGTGCCTCACTGGGCTTCGTGACGGAGCGCTTCGGCGAGCGGCTATGTCTCACGGT
ATACCTCGTCATCTGCATCGCCCTCGAGCTGGTCTTCTGGCTGGTGCCGCGCTTCATCGTGTCCGCCATTGCCGT
CATCCTCTTGGGCTTCTTCCTCGGTCCCATGTTCCCCGGCGGCGTCATGGTGACGGCCAAGTTGCTTCCTCGGCG
GATACACGTGAGCGCCATTGGGTTTGCCATGGCTATGGGAGGCAGCGGCGGCACCGTCTTCCCCTTCATCATCGG
CGCTATCGCTGCCAGTCAGGGCGTCAGGGTGCTGCAGCCCATCGTCCTGGCTCTCATCGTGCTGAACTTGATCCT
GTGGCTCAGCTTTCCGCGGATCAACAGGAGGGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail