Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1101
Gene name
Locationscaffold_134:17192..19902
Strand-
Gene length (bp)2710
Transcript length (bp)2409
Coding sequence length (bp)2406
Protein length (aa) 802

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20163 DUF6536 Family of unknown function (DUF6536) 9.7E-54 124 273

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 127 149 22
2 233 255 22
3 534 556 22
4 568 590 22
5 605 627 22
6 662 684 22
7 710 732 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1101
MAGLICLWALMDSLAIRRLDRSKLLLHCMPRTTRAAGKACYLRHQYEPPIKASGVANRMAEDLSIELTELDSCPP
VEENRLKEPEAESFRVTQFAQRSLLSSWFPSIDDDETKSWRIWISRRSRALMLQITVVGVIMTTNMVFTIFTIVR
YGSDNGIGLIFQGDCEAVKRLNQWLHLVINLLSTGMLSASNYCMQLQAAPTRANVDVAHEQGRWMDIGVPSIRNL
RYLTRGRLFTWGLLALSSIPVHLIYNSAVFQSLSSSSYAVAVVKDSFLRGSPWNLTAAEARAASDPAWDDTRVSP
DYINYTDIIQGLQQGATSYRRHNVSSCFEVYDDYWKPQGNAIILVGNETVQSPADDSLLMYAYIVPRWDDWGKNM
WALGNSTRQFTAQSPPHPVTTWYLGPQRYQVSGCLLQDPGGIRLTCRFQYSPPIMITICTMNMVKVCVMLWSWWA
RSGKGPETGDNQPLYTLGDAIASFMRRPDDMTANMCLATKDDFLRRRHSRWKFWKSVAPSPETGPRLFRKEPRLW
MQAASWRRWTLLMCLCTCTIAAGGPLLATALSSLGRRNMQTDFRSLLTLGFGATTPMTFLVTSLPRQDPAGLISS
VLLANLPQLLVSVIYILYNAMLSTFLVQREFSLMYKREKHKPLRVSEAVGIQRSSYFISLPLRYGVPLYASSGLM
HFLLSQSLFMARVTSLSPDGTVDKRASFSSCAYSPVAIITTMVAGTVLVASIVGLGFRRYDGMMRMVGTNSRAIS
AACHILEEDRADGYLLPVQWGVVEQTGGVGRCAFTTAPVHEVREPREGMEYR
Coding >Ophio5|1101
ATGGCTGGCCTCATCTGCCTCTGGGCGCTAATGGATAGCCTAGCTATCCGGCGTCTCGATAGGAGCAAGCTCTTA
CTGCACTGCATGCCAAGAACCACCCGAGCCGCTGGGAAAGCGTGCTACCTCCGTCATCAATATGAGCCCCCAATC
AAGGCCTCCGGCGTCGCAAATCGCATGGCAGAAGATCTGTCGATCGAACTGACAGAGCTCGACTCTTGTCCTCCC
GTCGAAGAGAACAGACTCAAGGAGCCCGAGGCTGAGAGCTTCCGCGTCACACAATTCGCCCAGCGCTCTCTTCTG
TCGAGCTGGTTCCCCAGCATCGACGACGACGAAACCAAATCATGGCGCATTTGGATCTCTCGGAGATCTCGTGCG
TTGATGTTGCAAATCACCGTCGTCGGCGTCATCATGACCACGAACATGGTCTTCACCATCTTTACCATCGTCAGG
TACGGTAGTGACAACGGCATCGGCCTGATATTCCAAGGAGACTGCGAGGCCGTCAAGAGGCTCAATCAGTGGCTC
CATCTCGTCATCAACCTCCTCAGCACCGGCATGCTGAGCGCAAGCAACTACTGCATGCAATTGCAGGCTGCGCCG
ACGAGAGCCAACGTCGACGTCGCTCACGAGCAGGGCAGGTGGATGGATATTGGCGTCCCCAGCATTCGGAATCTC
CGGTATCTGACACGCGGTCGCCTCTTCACCTGGGGCCTCCTCGCCTTGAGCTCAATTCCTGTTCACTTGATCTAC
AACTCGGCCGTCTTCCAATCCTTGTCGTCGAGCAGCTATGCCGTGGCCGTCGTCAAAGACTCCTTCCTCCGCGGC
AGTCCCTGGAATTTGACCGCGGCCGAGGCGCGTGCCGCCAGTGATCCGGCCTGGGACGACACTCGCGTCAGCCCA
GACTACATCAATTATACGGATATCATCCAGGGCTTGCAGCAGGGCGCAACTTCGTACCGACGACACAACGTCTCG
TCCTGCTTCGAGGTCTACGACGACTACTGGAAACCGCAGGGAAACGCCATCATCTTGGTAGGCAACGAGACGGTG
CAGAGCCCGGCCGACGATAGCCTTCTGATGTACGCCTACATCGTGCCGCGGTGGGACGACTGGGGGAAGAATATG
TGGGCGCTGGGCAACAGCACCAGACAGTTTACAGCGCAATCTCCGCCGCACCCGGTAACGACGTGGTATCTTGGG
CCGCAACGCTACCAAGTGTCCGGCTGCCTCTTGCAGGATCCCGGCGGCATCCGGCTCACCTGCCGCTTCCAGTAC
TCGCCCCCCATCATGATAACGATATGCACCATGAACATGGTCAAGGTGTGCGTCATGCTATGGTCCTGGTGGGCG
AGAAGTGGCAAGGGCCCGGAGACGGGTGATAACCAGCCTCTCTACACCCTCGGAGACGCCATTGCGTCCTTTATG
CGAAGGCCCGACGACATGACGGCCAACATGTGTCTCGCCACCAAGGACGACTTTCTGAGGCGGCGTCACAGCAGG
TGGAAGTTCTGGAAGTCGGTCGCGCCCAGCCCGGAGACTGGGCCTAGGTTATTTCGAAAGGAGCCCCGGCTGTGG
ATGCAAGCCGCCAGCTGGAGACGCTGGACTCTCCTGATGTGCCTGTGCACATGCACAATTGCCGCTGGAGGGCCT
CTGTTGGCCACGGCACTATCGAGCCTGGGCCGGCGCAACATGCAGACGGACTTCCGCAGCCTCCTAACCCTCGGC
TTCGGGGCGACGACGCCGATGACGTTTCTCGTGACGAGTCTGCCTCGTCAAGACCCAGCCGGGCTCATCTCGAGC
GTCTTGCTTGCCAACCTGCCGCAGTTGCTCGTCTCTGTCATCTACATACTCTACAATGCCATGCTGAGCACCTTT
CTCGTCCAGCGCGAGTTCAGCCTCATGTACAAGAGGGAGAAGCACAAGCCGCTGCGGGTTTCGGAAGCAGTCGGG
ATCCAGAGGTCGAGCTACTTTATTTCGCTGCCGCTGAGGTACGGCGTGCCGCTGTATGCCTCGTCGGGATTGATG
CATTTTCTGCTGAGCCAGAGCCTCTTTATGGCCAGGGTAACTTCGCTGTCCCCCGATGGCACCGTGGATAAGAGG
GCGTCGTTTTCGTCTTGCGCCTACAGCCCTGTGGCCATTATTACGACCATGGTTGCGGGTACGGTGCTGGTTGCG
TCCATTGTCGGTTTGGGATTCCGCCGATACGACGGGATGATGAGAATGGTGGGCACGAACAGCCGAGCCATCAGC
GCAGCGTGTCATATCCTGGAAGAGGATCGCGCGGACGGCTACCTCTTACCGGTACAGTGGGGGGTCGTGGAGCAG
ACGGGAGGTGTGGGGAGATGCGCTTTTACGACGGCCCCGGTTCATGAGGTGAGGGAGCCGAGGGAGGGGATGGAG
TATCGG
Transcript >Ophio5|1101
ATGGCTGGCCTCATCTGCCTCTGGGCGCTAATGGATAGCCTAGCTATCCGGCGTCTCGATAGGAGCAAGCTCTTA
CTGCACTGCATGCCAAGAACCACCCGAGCCGCTGGGAAAGCGTGCTACCTCCGTCATCAATATGAGCCCCCAATC
AAGGCCTCCGGCGTCGCAAATCGCATGGCAGAAGATCTGTCGATCGAACTGACAGAGCTCGACTCTTGTCCTCCC
GTCGAAGAGAACAGACTCAAGGAGCCCGAGGCTGAGAGCTTCCGCGTCACACAATTCGCCCAGCGCTCTCTTCTG
TCGAGCTGGTTCCCCAGCATCGACGACGACGAAACCAAATCATGGCGCATTTGGATCTCTCGGAGATCTCGTGCG
TTGATGTTGCAAATCACCGTCGTCGGCGTCATCATGACCACGAACATGGTCTTCACCATCTTTACCATCGTCAGG
TACGGTAGTGACAACGGCATCGGCCTGATATTCCAAGGAGACTGCGAGGCCGTCAAGAGGCTCAATCAGTGGCTC
CATCTCGTCATCAACCTCCTCAGCACCGGCATGCTGAGCGCAAGCAACTACTGCATGCAATTGCAGGCTGCGCCG
ACGAGAGCCAACGTCGACGTCGCTCACGAGCAGGGCAGGTGGATGGATATTGGCGTCCCCAGCATTCGGAATCTC
CGGTATCTGACACGCGGTCGCCTCTTCACCTGGGGCCTCCTCGCCTTGAGCTCAATTCCTGTTCACTTGATCTAC
AACTCGGCCGTCTTCCAATCCTTGTCGTCGAGCAGCTATGCCGTGGCCGTCGTCAAAGACTCCTTCCTCCGCGGC
AGTCCCTGGAATTTGACCGCGGCCGAGGCGCGTGCCGCCAGTGATCCGGCCTGGGACGACACTCGCGTCAGCCCA
GACTACATCAATTATACGGATATCATCCAGGGCTTGCAGCAGGGCGCAACTTCGTACCGACGACACAACGTCTCG
TCCTGCTTCGAGGTCTACGACGACTACTGGAAACCGCAGGGAAACGCCATCATCTTGGTAGGCAACGAGACGGTG
CAGAGCCCGGCCGACGATAGCCTTCTGATGTACGCCTACATCGTGCCGCGGTGGGACGACTGGGGGAAGAATATG
TGGGCGCTGGGCAACAGCACCAGACAGTTTACAGCGCAATCTCCGCCGCACCCGGTAACGACGTGGTATCTTGGG
CCGCAACGCTACCAAGTGTCCGGCTGCCTCTTGCAGGATCCCGGCGGCATCCGGCTCACCTGCCGCTTCCAGTAC
TCGCCCCCCATCATGATAACGATATGCACCATGAACATGGTCAAGGTGTGCGTCATGCTATGGTCCTGGTGGGCG
AGAAGTGGCAAGGGCCCGGAGACGGGTGATAACCAGCCTCTCTACACCCTCGGAGACGCCATTGCGTCCTTTATG
CGAAGGCCCGACGACATGACGGCCAACATGTGTCTCGCCACCAAGGACGACTTTCTGAGGCGGCGTCACAGCAGG
TGGAAGTTCTGGAAGTCGGTCGCGCCCAGCCCGGAGACTGGGCCTAGGTTATTTCGAAAGGAGCCCCGGCTGTGG
ATGCAAGCCGCCAGCTGGAGACGCTGGACTCTCCTGATGTGCCTGTGCACATGCACAATTGCCGCTGGAGGGCCT
CTGTTGGCCACGGCACTATCGAGCCTGGGCCGGCGCAACATGCAGACGGACTTCCGCAGCCTCCTAACCCTCGGC
TTCGGGGCGACGACGCCGATGACGTTTCTCGTGACGAGTCTGCCTCGTCAAGACCCAGCCGGGCTCATCTCGAGC
GTCTTGCTTGCCAACCTGCCGCAGTTGCTCGTCTCTGTCATCTACATACTCTACAATGCCATGCTGAGCACCTTT
CTCGTCCAGCGCGAGTTCAGCCTCATGTACAAGAGGGAGAAGCACAAGCCGCTGCGGGTTTCGGAAGCAGTCGGG
ATCCAGAGGTCGAGCTACTTTATTTCGCTGCCGCTGAGGTACGGCGTGCCGCTGTATGCCTCGTCGGGATTGATG
CATTTTCTGCTGAGCCAGAGCCTCTTTATGGCCAGGGTAACTTCGCTGTCCCCCGATGGCACCGTGGATAAGAGG
GCGTCGTTTTCGTCTTGCGCCTACAGCCCTGTGGCCATTATTACGACCATGGTTGCGGGTACGGTGCTGGTTGCG
TCCATTGTCGGTTTGGGATTCCGCCGATACGACGGGATGATGAGAATGGTGGGCACGAACAGCCGAGCCATCAGC
GCAGCGTGTCATATCCTGGAAGAGGATCGCGCGGACGGCTACCTCTTACCGGTACAGTGGGGGGTCGTGGAGCAG
ACGGGAGGTGTGGGGAGATGCGCTTTTACGACGGCCCCGGTTCATGAGGTGAGGGAGCCGAGGGAGGGGATGGAG
TATCGGTAG
Gene >Ophio5|1101
ATGGCTGGCCTCATCTGCCTCTGGGCGCTAATGGGTAACCTCATCTGACGCAGATCGTCGGTTGGCTGAAAGGCC
CATCTGAGACATTGGCTGACTGCGCAGCAGATAGCCTAGCTATCCGGCGTCTCGATAGGAGCAAGCTCTTACTGC
ACTGCATGCCAAGAACCACCCGAGCCGCTGGGAAAGCGTGCTACCTCCGTCATCAATATGAGCCCCCAATCAAGG
CCTCCGGCGTCTTTCATCATGTTGAACGGGATGCCACGCCTTCCAAGCGAAGCTAGGTCGCAAATCGCATGGCAG
AAGATCTGTCGATCGAACTGACAGAGCTCGACTCTTGTCCTCCCGTCGAAGAGAACAGACTCAAGGAGCCCGAGG
CTGAGAGCTTCCGCGTCACACAATTCGCCCAGCGCTCTCTTCTGTCGAGCTGGTTCCCCAGCATCGACGACGACG
AAACCAAATCATGGCGCATTTGGATCTCTCGGAGATCTCGTGCGTTGATGTTGCAAATCACCGTCGTCGGCGTCA
TCATGACCACGAACATGGTCTTCACCATCTTTACCATCGTCAGGTACGGTAGTGACAACGGCATCGGCCTGATAT
TCCAAGGAGACTGCGAGGCCGTCAAGAGGCTCAATCAGTGGCTCCATCTCGTCATCAACCTCCTCAGCACCGGCA
TGCTGAGCGCAAGCAACTACTGCATGCAATTGCAGGCTGCGCCGACGAGAGCCAACGTCGACGTCGCTCACGAGC
AGGGCAGGTGGATGGATATTGGCGTCCCCAGCATTCGGAATCTCCGGTATCTGACACGCGGTCGCCTCTTCACCT
GGGGCCTCCTCGCCTTGAGCTCAATTCCTGTTCACTTGATGTAAGTTGCCGTTCATTGAGTTTGAAATGTGGTTA
GTAACATCTAGGGGTCAGCTACAACTCGGCCGTCTTCCAATCCTTGTCGTCGAGCAGCTATGCCGTGGCCGTCGT
CAAAGACTCCTTCCTCCGCGGCAGTCCCTGGAATTTGACCGCGGCCGAGGCGCGTGCCGCCAGTGATCCGGCCTG
GGACGACACTCGCGTCAGCCCAGACTACATCAATTATACGGATATCATCCAGGGCTTGCAGCAGGGCGCAACTTC
GTACCGACGACACAACGTCTCGTCCTGCTTCGAGGTCTACGACGACTACTGGAAACCGCAGGGAAACGCCATCAT
CTTGGTAGGCAACGAGACGGTGCAGAGCCCGGCCGACGATAGCCTTCTGATGTACGCCTACATCGTGCCGCGGTG
GGACGACTGGGGGAAGAATATGTGGGCGCTGGGCAACAGCACCAGACAGTTTACAGCGCAATCTCCGCCGCACCC
GGTAACGACGTGGTATCTTGGGCCGCAACGCTACCAAGTGTCCGGCTGCCTCTTGCAGGATCCCGGCGGCATCCG
GCTCACCTGCCGCTTCCAGTACTCGCCCCCCATCATGATAACGATATGCACCATGAACATGGTCAAGGTGTGCGT
CATGCTATGGTCCTGGTGGGCGAGAAGTGGCAAGGGCCCGGAGACGGGTGATAACCAGCCTCTCTACACCCTCGG
AGACGCCATTGCGTCCTTTATGCGAAGGCCCGACGACATGACGGCCAACATGTGTCTCGCCACCAAGGACGACTT
TCTGAGGCGGCGTCACAGCAGGTGGAAGTTCTGGAAGTCGGTCGCGCCCAGCCCGGAGACTGGGCCTAGGTTATT
TCGAAAGGAGCCCCGGCTGTGGATGCAAGCCGCCAGCTGGAGACGCTGGACTCTCCTGATGTGCCTGTAAGTCGG
ATCTCAGAAGCCTTGATGGAGCCCTTGACGCCCCGTCCTAACGATTCGTGATGTACAGGTGCACATGCACAATTG
CCGCTGGAGGGCCTCTGTTGGCCACGGCACTATCGAGCCTGGGCCGGCGCAACATGCAGACGGACTTCCGCAGCC
TCCTAACCCTCGGCTTCGGGGCGACGACGCCGATGACGTTTCTCGTGACGAGTCTGCCTCGTCAAGACCCAGCCG
GGCTCATCTCGAGCGTCTTGCTTGCCAACCTGCCGCAGTTGCTCGTCTCTGTCATCTACATACTCTACAATGCCA
TGCTGAGCACCTTTCTCGTCCAGCGCGAGTTCAGCCTCATGTACAAGAGGGAGAAGCACAAGCCGCTGCGGGTTT
CGGAAGCAGTCGGGATCCAGAGGTCGAGCTACTTTATTTCGCTGCCGCTGAGGTACGGCGTGCCGCTGTATGCCT
CGTCGGGATTGATGCATTTTCTGCTGAGCCAGAGCCTCTTTATGGCCAGGGTAACTTCGCTGTCCCCCGATGGCA
CCGTGGATAAGAGGGCGTCGTTTTCGTCTTGCGCCTACAGCCCTGTGGCCATTATTACGAGTAGGTCACCTCCCC
TTCCTCCCCTTTCCTTCCCTTGCCAACGTCTCTGAAGCGCGTCGCAGCCATGGTTGCGGGTACGGTGCTGGTTGC
GTCCATTGTCGGTTTGGGATTCCGCCGATACGACGGGATGATGAGAATGGTGGGCACGAACAGCCGAGCCATCAG
CGCAGCGTGTCATATCCTGGAAGAGGATCGCGCGGACGGCTACCTCTTACCGGTACAGTGGGGGGTCGTGGAGCA
GACGGGAGGTGTGGGGAGATGCGCTTTTACGACGGCCCCGGTTCATGAGGTGAGGGAGCCGAGGGAGGGGATGGA
GTATCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail