Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|110
Gene name
Locationscaffold_100:16008..16804
Strand-
Gene length (bp)796
Transcript length (bp)744
Coding sequence length (bp)741
Protein length (aa) 247

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02466 Tim17 Tim17/Tim22/Tim23/Pmp24 family 1.3E-24 114 221

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USM7|TIM23_SCHPO Mitochondrial import inner membrane translocase subunit tim23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim23 PE=3 SV=1 40 233 1.0E-62
sp|P32897|TIM23_YEAST Mitochondrial import inner membrane translocase subunit TIM23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM23 PE=1 SV=1 42 235 3.0E-54
sp|O35093|TIM23_RAT Mitochondrial import inner membrane translocase subunit Tim23 OS=Rattus norvegicus GN=Timm23 PE=2 SV=1 85 230 2.0E-09
sp|Q7T2P6|TIM23_DANRE Mitochondrial import inner membrane translocase subunit Tim23 OS=Danio rerio GN=timm23 PE=2 SV=1 71 230 2.0E-09
sp|Q6INU6|TIM23_XENLA Mitochondrial import inner membrane translocase subunit Tim23 OS=Xenopus laevis GN=timm23 PE=2 SV=1 86 232 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USM7|TIM23_SCHPO Mitochondrial import inner membrane translocase subunit tim23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim23 PE=3 SV=1 40 233 1.0E-62
sp|P32897|TIM23_YEAST Mitochondrial import inner membrane translocase subunit TIM23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM23 PE=1 SV=1 42 235 3.0E-54
sp|O35093|TIM23_RAT Mitochondrial import inner membrane translocase subunit Tim23 OS=Rattus norvegicus GN=Timm23 PE=2 SV=1 85 230 2.0E-09
sp|Q7T2P6|TIM23_DANRE Mitochondrial import inner membrane translocase subunit Tim23 OS=Danio rerio GN=timm23 PE=2 SV=1 71 230 2.0E-09
sp|Q6INU6|TIM23_XENLA Mitochondrial import inner membrane translocase subunit Tim23 OS=Xenopus laevis GN=timm23 PE=2 SV=1 86 232 2.0E-08
sp|Q9LNQ1|TI231_ARATH Mitochondrial import inner membrane translocase subunit TIM23-1 OS=Arabidopsis thaliana GN=TIM23-1 PE=2 SV=1 101 211 2.0E-08
sp|Q9WTQ8|TIM23_MOUSE Mitochondrial import inner membrane translocase subunit Tim23 OS=Mus musculus GN=Timm23 PE=1 SV=1 85 234 3.0E-08
sp|Q5RDD0|TIM23_PONAB Mitochondrial import inner membrane translocase subunit Tim23 OS=Pongo abelii GN=TIMM23 PE=2 SV=1 85 230 3.0E-08
sp|O14925|TIM23_HUMAN Mitochondrial import inner membrane translocase subunit Tim23 OS=Homo sapiens GN=TIMM23 PE=1 SV=1 85 230 4.0E-08
sp|Q5XH94|TIM23_XENTR Mitochondrial import inner membrane translocase subunit Tim23 OS=Xenopus tropicalis GN=timm23 PE=2 SV=1 61 230 3.0E-07
sp|Q5SRD1|TI23B_HUMAN Putative mitochondrial import inner membrane translocase subunit Tim23B OS=Homo sapiens GN=TIMM23B PE=5 SV=2 85 210 3.0E-06
sp|A4IFL0|TIM23_BOVIN Mitochondrial import inner membrane translocase subunit Tim23 OS=Bos taurus GN=TIMM23 PE=2 SV=1 85 207 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 213 230 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|110
MSSLWNALTGSSKSSQGQAQSAVQTRAVGQTSPGLSEFAEPEPEPEPVKSPLSLTPGTDAYLHSSAFADPSQLHP
LAGLDKNALEYLTLDESALSDLPGGQSVLPSRGFTDDLCYGTGITYLMALSIGGAWGLQEGLRRSDGQPPKLRLN
SVLNAVTRRGPFLGNSAGAVAITYNCINSLIGHVRGKHAASNSVLAGALSGMVFKSTRGFRPMMISGGIVGSVAA
VWAIFRRSVFPVPDRGAPMVTL
Coding >Ophio5|110
ATGTCGTCGCTTTGGAACGCTCTCACCGGGAGCAGCAAGTCGTCACAGGGCCAGGCTCAATCTGCCGTTCAGACC
CGAGCTGTCGGCCAGACGTCGCCGGGCCTCAGCGAATTCGCCGAGCCTGAGCCTGAGCCTGAACCCGTCAAGTCG
CCGTTGTCGCTGACGCCGGGAACCGACGCCTACCTGCACAGTTCGGCCTTTGCCGACCCGTCGCAGCTGCACCCT
CTCGCGGGCCTCGACAAGAACGCGCTCGAGTATCTGACGCTCGACGAGTCGGCGCTGTCGGACCTACCCGGTGGC
CAGTCGGTGCTGCCTTCGCGGGGCTTTACCGACGATCTCTGCTACGGCACCGGCATCACGTACCTGATGGCCTTG
TCTATTGGCGGCGCTTGGGGCCTGCAGGAGGGGCTGCGAAGGTCGGATGGCCAGCCGCCCAAACTGCGCCTCAAC
TCGGTCCTCAATGCCGTCACCAGGCGTGGACCTTTTCTCGGCAACTCGGCCGGTGCTGTGGCCATCACGTACAAC
TGCATCAACTCGCTCATCGGTCATGTGCGTGGCAAGCACGCCGCATCGAACAGCGTCCTCGCCGGCGCGCTGAGC
GGCATGGTCTTTAAGAGCACCCGAGGTTTCCGACCAATGATGATTTCCGGCGGCATCGTTGGGTCCGTTGCCGCC
GTATGGGCCATCTTTCGGCGGAGTGTCTTTCCCGTGCCTGACCGCGGCGCTCCGATGGTGACGCTG
Transcript >Ophio5|110
ATGTCGTCGCTTTGGAACGCTCTCACCGGGAGCAGCAAGTCGTCACAGGGCCAGGCTCAATCTGCCGTTCAGACC
CGAGCTGTCGGCCAGACGTCGCCGGGCCTCAGCGAATTCGCCGAGCCTGAGCCTGAGCCTGAACCCGTCAAGTCG
CCGTTGTCGCTGACGCCGGGAACCGACGCCTACCTGCACAGTTCGGCCTTTGCCGACCCGTCGCAGCTGCACCCT
CTCGCGGGCCTCGACAAGAACGCGCTCGAGTATCTGACGCTCGACGAGTCGGCGCTGTCGGACCTACCCGGTGGC
CAGTCGGTGCTGCCTTCGCGGGGCTTTACCGACGATCTCTGCTACGGCACCGGCATCACGTACCTGATGGCCTTG
TCTATTGGCGGCGCTTGGGGCCTGCAGGAGGGGCTGCGAAGGTCGGATGGCCAGCCGCCCAAACTGCGCCTCAAC
TCGGTCCTCAATGCCGTCACCAGGCGTGGACCTTTTCTCGGCAACTCGGCCGGTGCTGTGGCCATCACGTACAAC
TGCATCAACTCGCTCATCGGTCATGTGCGTGGCAAGCACGCCGCATCGAACAGCGTCCTCGCCGGCGCGCTGAGC
GGCATGGTCTTTAAGAGCACCCGAGGTTTCCGACCAATGATGATTTCCGGCGGCATCGTTGGGTCCGTTGCCGCC
GTATGGGCCATCTTTCGGCGGAGTGTCTTTCCCGTGCCTGACCGCGGCGCTCCGATGGTGACGCTGTGA
Gene >Ophio5|110
ATGTCGTCGCTTTGGAACGCTCTCACCGGGAGCAGCAAGTCGTCACAGGGCCAGGCTCAATCTGCCGTTCAGACC
CGAGCTGTCGGCCAGACGTCGCCGGGCCTCAGCGAATTCGCCGAGCCTGAGCCTGAGCCTGAACCCGTCAAGTCG
CCGTTGTCGCTGACGCCGGGAACCGACGCCTACCTGCACAGTTCGGCCTTTGCCGACCCGTCGCAGCTGCACCCT
CTCGCGGGCCTCGACAAGAACGCGCTCGAGTATCTGACGCTCGACGAGTCGGCGCTGTCGGACCTACCCGGTGGC
CAGTCGGTGCTGCCTTCGCGGGGCTTTACCGACGATCTCTGCTACGGCACCGGCATCACGTACCTGATGGCCTTG
TCTATTGGCGGCGCTTGGGGCCTGCAGGAGGGGCTGCGAAGGTCGGATGGCCAGCCGCCCAAACTGCGCCTCAAC
TCGGTCCTCAATGCCGTCACCAGGCGTGGACCTTTTCTCGGCAACTCGGCCGGTGCTGTGGCCATCACGTACAAC
TGCATCAACTCGCTCATCGGTCATGTGCGTGGCAAGCACGCCGCATCGAACAGCGTCCTCGCCGGCGCGCTGAGC
GGCATGGTCTTTAAGAGCACCCGAGGTTTCCGACCAATGATGATTTCCGGCGGCATCGTTGGGTCCGTTGCCGCC
GTATGGGCCGTGAGTCTTGGGACAAAGAGTCTCGTCACTTGGTATGCTGATGAATGGGCAGATCTTTCGGCGGAG
TGTCTTTCCCGTGCCTGACCGCGGCGCTCCGATGGTGACGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail