Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1090
Gene name
Locationscaffold_1337:218..1751
Strand+
Gene length (bp)1533
Transcript length (bp)1533
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12430 ABA_GPCR Abscisic acid G-protein coupled receptor 4.7E-24 302 486
PF12537 GPHR_N The Golgi pH Regulator (GPHR) Family N-terminal 8.9E-22 170 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B5X1G3|GPHR_SALSA Golgi pH regulator OS=Salmo salar GN=gpr89 PE=2 SV=1 55 482 5.0E-16
sp|Q5F448|GPHR_CHICK Golgi pH regulator OS=Gallus gallus GN=GPR89 PE=2 SV=1 55 482 3.0E-15
sp|P0CG08|GPHRB_HUMAN Golgi pH regulator B OS=Homo sapiens GN=GPR89B PE=1 SV=1 55 482 3.0E-15
sp|B7ZAQ6|GPHRA_HUMAN Golgi pH regulator A OS=Homo sapiens GN=GPR89A PE=1 SV=2 55 482 3.0E-15
sp|Q8BS95|GPHR_MOUSE Golgi pH regulator OS=Mus musculus GN=Gpr89a PE=1 SV=2 55 331 9.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B5X1G3|GPHR_SALSA Golgi pH regulator OS=Salmo salar GN=gpr89 PE=2 SV=1 55 482 5.0E-16
sp|Q5F448|GPHR_CHICK Golgi pH regulator OS=Gallus gallus GN=GPR89 PE=2 SV=1 55 482 3.0E-15
sp|P0CG08|GPHRB_HUMAN Golgi pH regulator B OS=Homo sapiens GN=GPR89B PE=1 SV=1 55 482 3.0E-15
sp|B7ZAQ6|GPHRA_HUMAN Golgi pH regulator A OS=Homo sapiens GN=GPR89A PE=1 SV=2 55 482 3.0E-15
sp|Q8BS95|GPHR_MOUSE Golgi pH regulator OS=Mus musculus GN=Gpr89a PE=1 SV=2 55 331 9.0E-15
sp|Q5BIM9|GPHR_BOVIN Golgi pH regulator OS=Bos taurus GN=GPR89A PE=2 SV=2 55 482 2.0E-14
sp|B2ZXD5|GPHR_CRIGR Golgi pH regulator OS=Cricetulus griseus GN=GPR89 PE=2 SV=1 55 331 7.0E-14
sp|Q6DDW6|GPHR_XENLA Golgi pH regulator OS=Xenopus laevis GN=gpr89-b PE=2 SV=1 144 482 2.0E-13
sp|Q0WQG8|GTG2_ARATH GPCR-type G protein 2 OS=Arabidopsis thaliana GN=GTG2 PE=1 SV=2 55 473 1.0E-12
sp|Q9XIP7|GTG1_ARATH GPCR-type G protein 1 OS=Arabidopsis thaliana GN=GTG1 PE=1 SV=1 55 498 2.0E-12
sp|Q7X7S8|COLD1_ORYSJ GPCR-type G protein COLD1 OS=Oryza sativa subsp. japonica GN=COLD1 PE=1 SV=2 55 484 6.0E-12
sp|A2XX57|COLD1_ORYSI GPCR-type G protein COLD1 OS=Oryza sativa subsp. indica GN=COLD1 PE=3 SV=1 55 481 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 62 84 22
3 97 119 22
4 134 156 22
5 179 201 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1090
MWLTRSRASTTCGESCLPTTAWTKATVPLMGVLFCLVVVSILGRIFPRSEEKNNKEAGWRRAAIVWTFGAMLGLA
VALALLVMADVVDSTAGPVRDMALRLVVPALLFLLVCVAPWLECGSVVSCLMPCRRLGWMIQLGLFGLWLLVFWS
VGNMVPRSSRMIMTEFSSETLIRACLERVGVVGISLMAFLSGFASVSAPWHTFLRPWLRRRRVVTDDDVGRRKAG
LDSATDMLVTKRHLLRRLERRVDVGGEKGLVGNVLGLLRGGSQEAEMGALRVDIAALEEMEAGLAVELDVIRSER
AASTRLGKILSLPTYVFSLYCLYRITTTTLTTSQRILFPSNNPTASLQPSTTNPIIRLFSQATPAHLLDQQAALN
RTLTFLTSGLVLVAGARSATATLRLLSRCAPRRLVLLQLSDSMAPLAVAQTASAYALAAAMLLLRRFDMHAATGG
GRAVLGAALAPAFVDACFDACFLAGVGVSALGVAVVAALEVDDGSAVEGLVEARQDVKCL
Coding >Ophio5|1090
ATGTGGCTGACGCGGTCTCGGGCGTCGACGACCTGCGGAGAAAGCTGCCTACCGACGACGGCTTGGACGAAGGCG
ACGGTGCCTCTGATGGGGGTATTATTTTGTCTGGTTGTCGTCTCCATCCTCGGCCGCATCTTTCCCCGCTCCGAG
GAAAAGAACAACAAGGAAGCAGGATGGCGTCGGGCAGCGATCGTCTGGACCTTTGGCGCGATGCTCGGTCTCGCC
GTTGCCTTGGCGCTGCTGGTCATGGCGGATGTGGTGGATTCGACGGCTGGTCCGGTGCGGGACATGGCTCTTCGC
CTTGTTGTTCCCGCCTTACTTTTCCTACTCGTTTGCGTTGCGCCTTGGCTCGAGTGCGGGAGTGTGGTGAGCTGC
TTAATGCCCTGTCGACGGTTGGGTTGGATGATACAGCTCGGACTTTTTGGCCTGTGGTTGCTTGTCTTTTGGTCC
GTCGGGAACATGGTGCCCAGGTCTTCCAGGATGATCATGACGGAATTCTCGTCCGAGACGCTGATTCGCGCTTGT
TTGGAGAGGGTCGGTGTTGTCGGCATCTCTCTCATGGCTTTCCTATCCGGCTTTGCTTCCGTCTCGGCACCGTGG
CATACCTTTTTACGCCCTTGGTTGCGACGAAGGCGTGTCGTCACGGATGATGATGTCGGCCGCAGAAAGGCTGGC
CTGGATTCTGCTACCGACATGCTCGTCACAAAGCGTCATTTACTGCGTCGTCTTGAGCGCCGAGTCGATGTCGGG
GGTGAGAAAGGCTTGGTGGGCAACGTGCTTGGTTTGCTACGGGGCGGCAGCCAAGAGGCCGAGATGGGTGCTCTG
CGTGTCGACATCGCCGCCTTGGAGGAGATGGAGGCTGGTCTGGCCGTGGAACTTGATGTCATCCGCAGCGAAAGA
GCGGCCTCTACCCGACTCGGCAAAATCCTTTCCCTTCCGACCTACGTCTTCTCCCTCTACTGCCTCTACCGAATC
ACGACGACGACGCTCACAACCAGCCAACGAATCCTCTTCCCCAGCAACAACCCAACCGCCTCCCTTCAACCCTCA
ACCACGAACCCGATAATCCGCCTCTTCAGCCAAGCCACGCCCGCCCACCTCCTAGACCAACAAGCGGCTCTGAAC
CGAACGCTGACCTTCCTCACCAGCGGCCTCGTCCTCGTCGCCGGAGCACGCAGCGCGACGGCGACGCTGCGTCTG
CTATCACGCTGCGCACCGCGCCGACTGGTGCTGCTCCAACTGTCGGATTCCATGGCGCCTCTGGCCGTTGCGCAG
ACGGCTTCCGCCTACGCCTTGGCTGCTGCCATGCTGTTGTTGCGGAGGTTCGACATGCATGCGGCCACTGGTGGC
GGTAGGGCCGTTTTGGGCGCTGCTTTGGCTCCGGCCTTTGTCGACGCCTGTTTCGACGCCTGTTTCTTGGCTGGC
GTAGGCGTTTCCGCCCTCGGTGTTGCTGTGGTGGCTGCTTTGGAGGTCGATGATGGCTCAGCGGTGGAGGGCCTG
GTCGAGGCGCGGCAGGATGTGAAATGCCTG
Transcript >Ophio5|1090
ATGTGGCTGACGCGGTCTCGGGCGTCGACGACCTGCGGAGAAAGCTGCCTACCGACGACGGCTTGGACGAAGGCG
ACGGTGCCTCTGATGGGGGTATTATTTTGTCTGGTTGTCGTCTCCATCCTCGGCCGCATCTTTCCCCGCTCCGAG
GAAAAGAACAACAAGGAAGCAGGATGGCGTCGGGCAGCGATCGTCTGGACCTTTGGCGCGATGCTCGGTCTCGCC
GTTGCCTTGGCGCTGCTGGTCATGGCGGATGTGGTGGATTCGACGGCTGGTCCGGTGCGGGACATGGCTCTTCGC
CTTGTTGTTCCCGCCTTACTTTTCCTACTCGTTTGCGTTGCGCCTTGGCTCGAGTGCGGGAGTGTGGTGAGCTGC
TTAATGCCCTGTCGACGGTTGGGTTGGATGATACAGCTCGGACTTTTTGGCCTGTGGTTGCTTGTCTTTTGGTCC
GTCGGGAACATGGTGCCCAGGTCTTCCAGGATGATCATGACGGAATTCTCGTCCGAGACGCTGATTCGCGCTTGT
TTGGAGAGGGTCGGTGTTGTCGGCATCTCTCTCATGGCTTTCCTATCCGGCTTTGCTTCCGTCTCGGCACCGTGG
CATACCTTTTTACGCCCTTGGTTGCGACGAAGGCGTGTCGTCACGGATGATGATGTCGGCCGCAGAAAGGCTGGC
CTGGATTCTGCTACCGACATGCTCGTCACAAAGCGTCATTTACTGCGTCGTCTTGAGCGCCGAGTCGATGTCGGG
GGTGAGAAAGGCTTGGTGGGCAACGTGCTTGGTTTGCTACGGGGCGGCAGCCAAGAGGCCGAGATGGGTGCTCTG
CGTGTCGACATCGCCGCCTTGGAGGAGATGGAGGCTGGTCTGGCCGTGGAACTTGATGTCATCCGCAGCGAAAGA
GCGGCCTCTACCCGACTCGGCAAAATCCTTTCCCTTCCGACCTACGTCTTCTCCCTCTACTGCCTCTACCGAATC
ACGACGACGACGCTCACAACCAGCCAACGAATCCTCTTCCCCAGCAACAACCCAACCGCCTCCCTTCAACCCTCA
ACCACGAACCCGATAATCCGCCTCTTCAGCCAAGCCACGCCCGCCCACCTCCTAGACCAACAAGCGGCTCTGAAC
CGAACGCTGACCTTCCTCACCAGCGGCCTCGTCCTCGTCGCCGGAGCACGCAGCGCGACGGCGACGCTGCGTCTG
CTATCACGCTGCGCACCGCGCCGACTGGTGCTGCTCCAACTGTCGGATTCCATGGCGCCTCTGGCCGTTGCGCAG
ACGGCTTCCGCCTACGCCTTGGCTGCTGCCATGCTGTTGTTGCGGAGGTTCGACATGCATGCGGCCACTGGTGGC
GGTAGGGCCGTTTTGGGCGCTGCTTTGGCTCCGGCCTTTGTCGACGCCTGTTTCGACGCCTGTTTCTTGGCTGGC
GTAGGCGTTTCCGCCCTCGGTGTTGCTGTGGTGGCTGCTTTGGAGGTCGATGATGGCTCAGCGGTGGAGGGCCTG
GTCGAGGCGCGGCAGGATGTGAAATGCCTGTAG
Gene >Ophio5|1090
ATGTGGCTGACGCGGTCTCGGGCGTCGACGACCTGCGGAGAAAGCTGCCTACCGACGACGGCTTGGACGAAGGCG
ACGGTGCCTCTGATGGGGGTATTATTTTGTCTGGTTGTCGTCTCCATCCTCGGCCGCATCTTTCCCCGCTCCGAG
GAAAAGAACAACAAGGAAGCAGGATGGCGTCGGGCAGCGATCGTCTGGACCTTTGGCGCGATGCTCGGTCTCGCC
GTTGCCTTGGCGCTGCTGGTCATGGCGGATGTGGTGGATTCGACGGCTGGTCCGGTGCGGGACATGGCTCTTCGC
CTTGTTGTTCCCGCCTTACTTTTCCTACTCGTTTGCGTTGCGCCTTGGCTCGAGTGCGGGAGTGTGGTGAGCTGC
TTAATGCCCTGTCGACGGTTGGGTTGGATGATACAGCTCGGACTTTTTGGCCTGTGGTTGCTTGTCTTTTGGTCC
GTCGGGAACATGGTGCCCAGGTCTTCCAGGATGATCATGACGGAATTCTCGTCCGAGACGCTGATTCGCGCTTGT
TTGGAGAGGGTCGGTGTTGTCGGCATCTCTCTCATGGCTTTCCTATCCGGCTTTGCTTCCGTCTCGGCACCGTGG
CATACCTTTTTACGCCCTTGGTTGCGACGAAGGCGTGTCGTCACGGATGATGATGTCGGCCGCAGAAAGGCTGGC
CTGGATTCTGCTACCGACATGCTCGTCACAAAGCGTCATTTACTGCGTCGTCTTGAGCGCCGAGTCGATGTCGGG
GGTGAGAAAGGCTTGGTGGGCAACGTGCTTGGTTTGCTACGGGGCGGCAGCCAAGAGGCCGAGATGGGTGCTCTG
CGTGTCGACATCGCCGCCTTGGAGGAGATGGAGGCTGGTCTGGCCGTGGAACTTGATGTCATCCGCAGCGAAAGA
GCGGCCTCTACCCGACTCGGCAAAATCCTTTCCCTTCCGACCTACGTCTTCTCCCTCTACTGCCTCTACCGAATC
ACGACGACGACGCTCACAACCAGCCAACGAATCCTCTTCCCCAGCAACAACCCAACCGCCTCCCTTCAACCCTCA
ACCACGAACCCGATAATCCGCCTCTTCAGCCAAGCCACGCCCGCCCACCTCCTAGACCAACAAGCGGCTCTGAAC
CGAACGCTGACCTTCCTCACCAGCGGCCTCGTCCTCGTCGCCGGAGCACGCAGCGCGACGGCGACGCTGCGTCTG
CTATCACGCTGCGCACCGCGCCGACTGGTGCTGCTCCAACTGTCGGATTCCATGGCGCCTCTGGCCGTTGCGCAG
ACGGCTTCCGCCTACGCCTTGGCTGCTGCCATGCTGTTGTTGCGGAGGTTCGACATGCATGCGGCCACTGGTGGC
GGTAGGGCCGTTTTGGGCGCTGCTTTGGCTCCGGCCTTTGTCGACGCCTGTTTCGACGCCTGTTTCTTGGCTGGC
GTAGGCGTTTCCGCCCTCGGTGTTGCTGTGGTGGCTGCTTTGGAGGTCGATGATGGCTCAGCGGTGGAGGGCCTG
GTCGAGGCGCGGCAGGATGTGAAATGCCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail