Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1089
Gene name
Locationscaffold_1333:806..1859
Strand+
Gene length (bp)1053
Transcript length (bp)1053
Coding sequence length (bp)1050
Protein length (aa) 350

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263) 9.5E-08 95 158

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6075 0.5522 0.1606 0.0616 0.264 0.0307 0.0428 0.1774 0.2319 0.0278

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1701
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1879
Ophiocordyceps australis map64 (Brazil) OphauB2|7627
Ophiocordyceps camponoti-floridani Ophcf2|00561
Ophiocordyceps camponoti-rufipedis Ophun1|1368
Ophiocordyceps kimflemingae Ophio5|1089 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1493

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1089
MPPASRSGRVRPADVAAETRRNFIPLINAHHAHEFPPYSVLYRQPVVQLDIRRRVSSTRPPVFRFVAGDPVMTAD
SCGVSDSQTSGGPRIRIPFICAANERRPGGDWETGCSGYEENLCRRSNLSATLSKPDPSTGETSNYPIPTAGGIL
SNSVVVWRGPHDRYDQLDNWYDLPVVSVPPTRWPKLKDNGSRYSFSEERDMMREKMRGALRICLYHNYDRVVIGD
FGLGNSCRNPPQEVAEIWRDVFLFDPDMRGQFAYVVFAFEDAQQSTTRMILDEIARRDRTNGGRSAGAPSSSSTG
PATSPEASSSAAQAEAPTDISIFQQVFEDSEIERVLSAPDPRYDLNMITS
Coding >Ophio5|1089
ATGCCACCGGCATCCAGGTCCGGCAGGGTGAGGCCGGCCGACGTGGCGGCGGAAACCAGGAGGAACTTTATACCC
CTAATCAACGCGCACCACGCGCACGAATTCCCCCCCTACTCTGTGCTGTACCGGCAGCCGGTGGTGCAGCTGGAC
ATACGACGACGGGTTTCGAGCACCCGCCCGCCCGTCTTCCGCTTCGTGGCGGGGGACCCCGTCATGACGGCCGAC
TCGTGTGGCGTGTCGGACAGCCAGACGAGCGGAGGGCCCCGGATCCGCATCCCCTTCATATGCGCCGCCAACGAG
CGCCGCCCCGGAGGCGACTGGGAGACGGGCTGTTCCGGGTATGAAGAGAATCTCTGCCGGCGGAGTAACCTGTCG
GCCACGCTCAGCAAGCCGGACCCAAGCACAGGAGAGACGTCCAACTACCCCATCCCTACGGCCGGCGGCATCCTG
TCAAACTCGGTCGTGGTCTGGCGGGGCCCCCATGATCGCTACGACCAGCTCGATAACTGGTATGACCTGCCTGTC
GTGTCCGTGCCTCCGACGCGGTGGCCAAAACTCAAGGACAATGGGTCCAGATACTCGTTCTCGGAAGAGCGCGAC
ATGATGCGCGAGAAGATGCGAGGCGCTCTACGGATATGCCTCTATCACAATTATGACCGCGTCGTCATCGGCGAC
TTTGGCCTGGGCAACAGCTGCCGGAACCCGCCGCAGGAGGTGGCCGAGATCTGGCGCGACGTCTTCCTCTTCGAC
CCAGACATGCGAGGCCAGTTCGCCTACGTCGTCTTTGCGTTTGAGGACGCGCAGCAGAGCACGACGCGCATGATT
CTCGATGAGATTGCCAGGAGGGATCGGACCAACGGCGGCCGGTCGGCCGGCGCGCCCAGCTCGTCGTCGACGGGG
CCGGCGACGTCACCCGAGGCATCTTCGTCGGCGGCCCAGGCCGAGGCCCCGACCGACATTAGCATCTTCCAGCAA
GTGTTTGAGGACTCCGAGATTGAGCGGGTCCTCAGCGCACCGGACCCGCGCTACGACCTGAACATGATCACGTCA
Transcript >Ophio5|1089
ATGCCACCGGCATCCAGGTCCGGCAGGGTGAGGCCGGCCGACGTGGCGGCGGAAACCAGGAGGAACTTTATACCC
CTAATCAACGCGCACCACGCGCACGAATTCCCCCCCTACTCTGTGCTGTACCGGCAGCCGGTGGTGCAGCTGGAC
ATACGACGACGGGTTTCGAGCACCCGCCCGCCCGTCTTCCGCTTCGTGGCGGGGGACCCCGTCATGACGGCCGAC
TCGTGTGGCGTGTCGGACAGCCAGACGAGCGGAGGGCCCCGGATCCGCATCCCCTTCATATGCGCCGCCAACGAG
CGCCGCCCCGGAGGCGACTGGGAGACGGGCTGTTCCGGGTATGAAGAGAATCTCTGCCGGCGGAGTAACCTGTCG
GCCACGCTCAGCAAGCCGGACCCAAGCACAGGAGAGACGTCCAACTACCCCATCCCTACGGCCGGCGGCATCCTG
TCAAACTCGGTCGTGGTCTGGCGGGGCCCCCATGATCGCTACGACCAGCTCGATAACTGGTATGACCTGCCTGTC
GTGTCCGTGCCTCCGACGCGGTGGCCAAAACTCAAGGACAATGGGTCCAGATACTCGTTCTCGGAAGAGCGCGAC
ATGATGCGCGAGAAGATGCGAGGCGCTCTACGGATATGCCTCTATCACAATTATGACCGCGTCGTCATCGGCGAC
TTTGGCCTGGGCAACAGCTGCCGGAACCCGCCGCAGGAGGTGGCCGAGATCTGGCGCGACGTCTTCCTCTTCGAC
CCAGACATGCGAGGCCAGTTCGCCTACGTCGTCTTTGCGTTTGAGGACGCGCAGCAGAGCACGACGCGCATGATT
CTCGATGAGATTGCCAGGAGGGATCGGACCAACGGCGGCCGGTCGGCCGGCGCGCCCAGCTCGTCGTCGACGGGG
CCGGCGACGTCACCCGAGGCATCTTCGTCGGCGGCCCAGGCCGAGGCCCCGACCGACATTAGCATCTTCCAGCAA
GTGTTTGAGGACTCCGAGATTGAGCGGGTCCTCAGCGCACCGGACCCGCGCTACGACCTGAACATGATCACGTCA
TGA
Gene >Ophio5|1089
ATGCCACCGGCATCCAGGTCCGGCAGGGTGAGGCCGGCCGACGTGGCGGCGGAAACCAGGAGGAACTTTATACCC
CTAATCAACGCGCACCACGCGCACGAATTCCCCCCCTACTCTGTGCTGTACCGGCAGCCGGTGGTGCAGCTGGAC
ATACGACGACGGGTTTCGAGCACCCGCCCGCCCGTCTTCCGCTTCGTGGCGGGGGACCCCGTCATGACGGCCGAC
TCGTGTGGCGTGTCGGACAGCCAGACGAGCGGAGGGCCCCGGATCCGCATCCCCTTCATATGCGCCGCCAACGAG
CGCCGCCCCGGAGGCGACTGGGAGACGGGCTGTTCCGGGTATGAAGAGAATCTCTGCCGGCGGAGTAACCTGTCG
GCCACGCTCAGCAAGCCGGACCCAAGCACAGGAGAGACGTCCAACTACCCCATCCCTACGGCCGGCGGCATCCTG
TCAAACTCGGTCGTGGTCTGGCGGGGCCCCCATGATCGCTACGACCAGCTCGATAACTGGTATGACCTGCCTGTC
GTGTCCGTGCCTCCGACGCGGTGGCCAAAACTCAAGGACAATGGGTCCAGATACTCGTTCTCGGAAGAGCGCGAC
ATGATGCGCGAGAAGATGCGAGGCGCTCTACGGATATGCCTCTATCACAATTATGACCGCGTCGTCATCGGCGAC
TTTGGCCTGGGCAACAGCTGCCGGAACCCGCCGCAGGAGGTGGCCGAGATCTGGCGCGACGTCTTCCTCTTCGAC
CCAGACATGCGAGGCCAGTTCGCCTACGTCGTCTTTGCGTTTGAGGACGCGCAGCAGAGCACGACGCGCATGATT
CTCGATGAGATTGCCAGGAGGGATCGGACCAACGGCGGCCGGTCGGCCGGCGCGCCCAGCTCGTCGTCGACGGGG
CCGGCGACGTCACCCGAGGCATCTTCGTCGGCGGCCCAGGCCGAGGCCCCGACCGACATTAGCATCTTCCAGCAA
GTGTTTGAGGACTCCGAGATTGAGCGGGTCCTCAGCGCACCGGACCCGCGCTACGACCTGAACATGATCACGTCA
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail