Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1087
Gene name
Locationscaffold_1332:570..1198
Strand+
Gene length (bp)628
Transcript length (bp)426
Coding sequence length (bp)423
Protein length (aa) 141

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 49.08 18.26 79.91
CcL In ants, during behavior modification 18.38 4.24 32.52
CcD In ants, recently dead 11.48 1.96 21.01

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.005848 yes
SC16a CcD 0.000535 yes
CcL CcD 0.262009 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1087
MSSLIKASPTWKLLIYLSLKSKNKRLDSSQLAATRLQYSNQPRTLSPVPLYSIGRQLSSGSLVGLISGVIITIFS
QAIALLATSVILSYYMLALRLNIKTLDLLSIVPRRWRSKLFSDFRRDKWFFASFICTFILTICVHI
Coding >Ophio5|1087
ATGAGTTCTCTTATTAAGGCATCTCCTACTTGGAAACTCCTTATATATTTATCGCTGAAATCAAAAAACAAACGT
CTCGATTCTAGTCAGCTAGCTGCTACGCGACTCCAATATTCCAATCAACCGCGAACTTTGAGTCCTGTGCCATTA
TACTCAATTGGTCGGCAGCTATCTAGCGGAAGTTTAGTCGGGCTTATTTCGGGAGTCATTATCACAATTTTTTCT
CAAGCTATAGCTCTCCTTGCGACCTCGGTAATTTTATCTTATTATATGCTTGCTTTACGGCTTAATATTAAGACC
CTCGATCTGCTTAGTATCGTTCCCAGACGCTGGCGGAGCAAATTATTCAGCGACTTTCGTAGAGACAAATGGTTC
TTTGCTTCCTTTATATGTACTTTCATTCTCACTATTTGCGTTCATATT
Transcript >Ophio5|1087
ATGAGTTCTCTTATTAAGGCATCTCCTACTTGGAAACTCCTTATATATTTATCGCTGAAATCAAAAAACAAACGT
CTCGATTCTAGTCAGCTAGCTGCTACGCGACTCCAATATTCCAATCAACCGCGAACTTTGAGTCCTGTGCCATTA
TACTCAATTGGTCGGCAGCTATCTAGCGGAAGTTTAGTCGGGCTTATTTCGGGAGTCATTATCACAATTTTTTCT
CAAGCTATAGCTCTCCTTGCGACCTCGGTAATTTTATCTTATTATATGCTTGCTTTACGGCTTAATATTAAGACC
CTCGATCTGCTTAGTATCGTTCCCAGACGCTGGCGGAGCAAATTATTCAGCGACTTTCGTAGAGACAAATGGTTC
TTTGCTTCCTTTATATGTACTTTCATTCTCACTATTTGCGTTCATATTTAG
Gene >Ophio5|1087
ATGAGTTCTCTTATTAAGGCATCTCCTACTTGGAAACGTTATTATAGCCGCCTACTAGTAAAGACTAGACCGAGT
ATTTACGCTGGGACAGTCCTTATATATTTATCGCTGAAATCAAAAAACAAACGTCTCGATTCTAGTCAGCTAGCT
GCTACGCGACTCCAATATTCCAATCAACCGCGAACTTTGAGTCCTGTGCCATTATACTCAATTGGTCGGCAGCTA
TCTAGCGGAAGTTTAGTCGGTGCGTACCTTTTGCAATAGCACTAACATTACTGAACGTGCTGCTCTCCTATTATC
GACCTTTCTAAAATTTATCCCAGGGCTTATTTCGGGAGTCATTATCACAATTTTTTCTCAAGCTATAGCTCTCCT
TGCGACCTCGGTAATTTTATCTTATTATATGGTGCGATTATTTGTTAAAATCTATCCGCCTATATTCTCTTTACT
AACTATACCTATACAACATTCAAAGCTTGCTTTACGGCTTAATATTAAGACCCTCGATCTGCTTAGTATCGTTCC
CAGACGCTGGCGGAGCAAATTATTCAGCGACTTTCGTAGAGACAAATGGTTCTTTGCTTCCTTTATATGTACTTT
CATTCTCACTATTTGCGTTCATATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail