Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1061
Gene name
Locationscaffold_132:31172..32618
Strand+
Gene length (bp)1446
Transcript length (bp)1323
Coding sequence length (bp)1320
Protein length (aa) 440

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05057 DUF676 Putative serine esterase (DUF676) 1.3E-53 15 213

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08448|YO059_YEAST Putative lipase YOR059C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR059C PE=1 SV=1 19 417 1.0E-33
sp|P53118|ROG1_YEAST Putative lipase ROG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROG1 PE=1 SV=1 19 215 3.0E-14
sp|O14162|YE7A_SCHPO Putative lipase C4A8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.10 PE=3 SV=2 19 233 5.0E-13
sp|Q12103|YD109_YEAST Putative lipase YDL109C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL109C PE=1 SV=1 16 215 3.0E-11
sp|Q6NS59|F135A_MOUSE Protein FAM135A OS=Mus musculus GN=Fam135a PE=1 SV=2 3 216 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08448|YO059_YEAST Putative lipase YOR059C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR059C PE=1 SV=1 19 417 1.0E-33
sp|P53118|ROG1_YEAST Putative lipase ROG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROG1 PE=1 SV=1 19 215 3.0E-14
sp|O14162|YE7A_SCHPO Putative lipase C4A8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.10 PE=3 SV=2 19 233 5.0E-13
sp|Q12103|YD109_YEAST Putative lipase YDL109C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL109C PE=1 SV=1 16 215 3.0E-11
sp|Q6NS59|F135A_MOUSE Protein FAM135A OS=Mus musculus GN=Fam135a PE=1 SV=2 3 216 2.0E-08
sp|Q9P2D6|F135A_HUMAN Protein FAM135A OS=Homo sapiens GN=FAM135A PE=1 SV=2 6 216 2.0E-08
sp|Q5RA75|F135A_PONAB Protein FAM135A OS=Pongo abelii GN=FAM135A PE=2 SV=1 6 135 2.0E-08
sp|Q04093|YD444_YEAST Putative lipase YDR444W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR444W PE=1 SV=1 19 228 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 271 293 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1061
MPAPEQDEDYMGGSHEADHLCVLVHGLWGDPSHMRNIAKALRSQYPRDRLCLLLAKRNSGSFTYDGIELGGERVC
AEIEEELQSRAGKVKKLSIVGYSLGGLVSRYAVGLLYAKGLLDNVQCMNFVTFASPHLGVRSPLKGWHNYIWNYV
GARSLSMSGRQLFTIDKFRDTGRPLLSVLADPASIFMRGIRNFKRRTLYANVVNDRSAVYYTTCIKKTDPYRNID
KIEPNYVEGYGSVILDPKVPYKLRPDSKSSLSSTTSTALMWVKRLPLILMVAVFVPAGTIAFLCNSVFQTVKSSS
RIRQHEAGRANVNIQEYRVPLVLKEMRGEMEKAYGALNSSQSQEFLAAEDVNVDAGMGANERLVMSQERRQSVSA
QPTLALTAHQFQMIRALDELQWRKIPVWIHNDRHSHAAIIVRFPKKSFDEGFLVLRHFAQDEFLM
Coding >Ophio5|1061
ATGCCGGCACCGGAGCAAGACGAAGACTACATGGGCGGCAGCCATGAGGCCGACCATCTCTGTGTTCTCGTTCAC
GGGCTCTGGGGCGATCCCAGTCACATGAGGAACATTGCCAAAGCGCTGCGGTCTCAGTATCCACGAGATCGGCTT
TGCTTGCTACTCGCGAAACGCAACAGCGGGAGCTTTACCTATGACGGCATCGAGCTCGGAGGGGAGCGCGTCTGC
GCCGAGATTGAGGAGGAACTGCAGAGTCGTGCAGGCAAGGTCAAGAAGCTCAGCATTGTTGGCTACTCCCTCGGG
GGATTGGTATCCCGCTACGCCGTTGGCCTCCTATATGCAAAAGGCCTACTTGATAATGTCCAGTGCATGAATTTC
GTCACCTTCGCATCGCCCCATCTCGGGGTTCGGTCTCCGCTGAAGGGCTGGCATAACTACATCTGGAACTACGTG
GGCGCGCGGAGCCTTTCCATGTCAGGAAGGCAGCTCTTTACCATCGACAAGTTTCGCGACACTGGCCGGCCGTTG
CTGTCCGTCCTTGCCGACCCCGCGTCCATCTTCATGCGCGGCATTCGGAACTTCAAGCGTCGAACGCTGTACGCC
AATGTAGTCAACGACAGGAGTGCCGTCTATTACACGACATGCATCAAGAAGACAGATCCTTACCGAAATATTGAC
AAAATCGAGCCCAATTACGTCGAGGGGTACGGAAGCGTTATCTTGGATCCAAAGGTCCCCTATAAGCTGCGGCCC
GACTCCAAATCCAGTCTCTCGTCGACGACGAGCACGGCTCTGATGTGGGTGAAGCGCTTGCCTCTCATACTCATG
GTTGCCGTGTTCGTTCCCGCCGGTACCATTGCGTTTCTATGCAATTCTGTCTTCCAAACGGTGAAGAGCTCGAGC
AGAATCAGGCAACATGAGGCGGGCCGAGCCAACGTCAACATTCAAGAGTACCGCGTGCCATTGGTGCTCAAGGAG
ATGCGTGGGGAGATGGAAAAGGCGTACGGCGCGCTCAACAGCTCGCAAAGTCAGGAATTTCTGGCAGCCGAGGAC
GTAAATGTCGACGCCGGTATGGGAGCGAATGAAAGGCTCGTCATGAGCCAGGAGCGGAGGCAGTCGGTATCGGCA
CAGCCGACGCTGGCCCTGACGGCGCACCAGTTCCAGATGATACGGGCCCTCGATGAGCTGCAGTGGCGCAAGATT
CCGGTGTGGATTCACAACGACCGACACAGCCATGCAGCCATTATTGTCCGATTTCCGAAGAAAAGCTTCGATGAG
GGCTTCTTGGTGTTGAGGCACTTTGCCCAGGACGAGTTTCTCATG
Transcript >Ophio5|1061
ATGCCGGCACCGGAGCAAGACGAAGACTACATGGGCGGCAGCCATGAGGCCGACCATCTCTGTGTTCTCGTTCAC
GGGCTCTGGGGCGATCCCAGTCACATGAGGAACATTGCCAAAGCGCTGCGGTCTCAGTATCCACGAGATCGGCTT
TGCTTGCTACTCGCGAAACGCAACAGCGGGAGCTTTACCTATGACGGCATCGAGCTCGGAGGGGAGCGCGTCTGC
GCCGAGATTGAGGAGGAACTGCAGAGTCGTGCAGGCAAGGTCAAGAAGCTCAGCATTGTTGGCTACTCCCTCGGG
GGATTGGTATCCCGCTACGCCGTTGGCCTCCTATATGCAAAAGGCCTACTTGATAATGTCCAGTGCATGAATTTC
GTCACCTTCGCATCGCCCCATCTCGGGGTTCGGTCTCCGCTGAAGGGCTGGCATAACTACATCTGGAACTACGTG
GGCGCGCGGAGCCTTTCCATGTCAGGAAGGCAGCTCTTTACCATCGACAAGTTTCGCGACACTGGCCGGCCGTTG
CTGTCCGTCCTTGCCGACCCCGCGTCCATCTTCATGCGCGGCATTCGGAACTTCAAGCGTCGAACGCTGTACGCC
AATGTAGTCAACGACAGGAGTGCCGTCTATTACACGACATGCATCAAGAAGACAGATCCTTACCGAAATATTGAC
AAAATCGAGCCCAATTACGTCGAGGGGTACGGAAGCGTTATCTTGGATCCAAAGGTCCCCTATAAGCTGCGGCCC
GACTCCAAATCCAGTCTCTCGTCGACGACGAGCACGGCTCTGATGTGGGTGAAGCGCTTGCCTCTCATACTCATG
GTTGCCGTGTTCGTTCCCGCCGGTACCATTGCGTTTCTATGCAATTCTGTCTTCCAAACGGTGAAGAGCTCGAGC
AGAATCAGGCAACATGAGGCGGGCCGAGCCAACGTCAACATTCAAGAGTACCGCGTGCCATTGGTGCTCAAGGAG
ATGCGTGGGGAGATGGAAAAGGCGTACGGCGCGCTCAACAGCTCGCAAAGTCAGGAATTTCTGGCAGCCGAGGAC
GTAAATGTCGACGCCGGTATGGGAGCGAATGAAAGGCTCGTCATGAGCCAGGAGCGGAGGCAGTCGGTATCGGCA
CAGCCGACGCTGGCCCTGACGGCGCACCAGTTCCAGATGATACGGGCCCTCGATGAGCTGCAGTGGCGCAAGATT
CCGGTGTGGATTCACAACGACCGACACAGCCATGCAGCCATTATTGTCCGATTTCCGAAGAAAAGCTTCGATGAG
GGCTTCTTGGTGTTGAGGCACTTTGCCCAGGACGAGTTTCTCATGTAG
Gene >Ophio5|1061
ATGCCGGCACCGGAGCAAGACGAAGACTACATGGGCGGCAGCCATGAGGCCGACCATCTCTGTGTTCTCGTTCAC
GGGGTGAGTTAGGAGTCATGTCTCTTGTCCGAAAAGGACTTCGCCGCTCATACGCTGGCTCAGCTCTGGGGCGAT
CCCAGTCACATGAGGAACATTGCCAAAGCGCTGCGGTCTCAGTATCCACGAGATCGGCTTTGCTTGCTACTCGCG
AAACGCAACAGCGGGAGCTTTACCTATGACGGCATCGAGCTCGGAGGGGAGCGCGTCTGCGCCGAGATTGAGGAG
GAACTGCAGAGTCGTGCAGGCAAGGTCAAGAAGCTCAGCATTGTTGGCTACTCCCTCGGGGGATTGGTATCCCGC
TACGCCGTTGGCCTCCTATATGCAAAAGGCCTACTTGATAATGTCCAGTGCATGGTAGGCGGAGGCTTCGACTGC
CAAACGTCTTGATCGCGAGCTGACGTCCGAGACATCGCCCAGAATTTCGTCACCTTCGCATCGCCCCATCTCGGG
GTTCGGTCTCCGCTGAAGGGCTGGCATAACTACATCTGGAACTACGTGGGCGCGCGGAGCCTTTCCATGTCAGGA
AGGCAGCTCTTTACCATCGACAAGTTTCGCGACACTGGCCGGCCGTTGCTGTCCGTCCTTGCCGACCCCGCGTCC
ATCTTCATGCGCGGCATTCGGAACTTCAAGCGTCGAACGCTGTACGCCAATGTAGTCAACGACAGGAGTGCCGTC
TATTACACGACATGCATCAAGAAGACAGATCCTTACCGAAATATTGACAAAATCGAGCCCAATTACGTCGAGGGG
TACGGAAGCGTTATCTTGGATCCAAAGGTCCCCTATAAGCTGCGGCCCGACTCCAAATCCAGTCTCTCGTCGACG
ACGAGCACGGCTCTGATGTGGGTGAAGCGCTTGCCTCTCATACTCATGGTTGCCGTGTTCGTTCCCGCCGGTACC
ATTGCGTTTCTATGCAATTCTGTCTTCCAAACGGTGAAGAGCTCGAGCAGAATCAGGCAACATGAGGCGGGCCGA
GCCAACGTCAACATTCAAGAGTACCGCGTGCCATTGGTGCTCAAGGAGATGCGTGGGGAGATGGAAAAGGCGTAC
GGCGCGCTCAACAGCTCGCAAAGTCAGGAATTTCTGGCAGCCGAGGACGTAAATGTCGACGCCGGTATGGGAGCG
AATGAAAGGCTCGTCATGAGCCAGGAGCGGAGGCAGTCGGTATCGGCACAGCCGACGCTGGCCCTGACGGCGCAC
CAGTTCCAGATGATACGGGCCCTCGATGAGCTGCAGTGGCGCAAGATTCCGGTGTGGATTCACAACGACCGACAC
AGCCATGCAGCCATTATTGTCCGATTTCCGAAGAAAAGCTTCGATGAGGGCTTCTTGGTGTTGAGGCACTTTGCC
CAGGACGAGTTTCTCATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail