Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1055
Gene name
Locationscaffold_132:20667..21960
Strand-
Gene length (bp)1293
Transcript length (bp)1062
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00503 G-alpha G-protein alpha subunit 4.7E-124 14 342
PF00025 Arf ADP-ribosylation factor family 2.9E-10 176 274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00580|GPA1_CRYPA Guanine nucleotide-binding protein subunit alpha OS=Cryphonectria parasitica PE=3 SV=3 1 353 0.0E+00
sp|O42784|GPA1_COLTR Guanine nucleotide-binding protein subunit alpha OS=Colletotrichum trifolii GN=CTG1 PE=2 SV=3 1 353 0.0E+00
sp|O13315|GPA1_MAGO7 Guanine nucleotide-binding protein subunit alpha OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MAGB PE=3 SV=4 1 353 0.0E+00
sp|Q05425|GPA1_NEUCR Guanine nucleotide-binding protein alpha-1 subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gna-1 PE=2 SV=1 1 353 0.0E+00
sp|O74259|GPA1_SPOS1 Guanine nucleotide-binding protein subunit alpha OS=Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) GN=SSG-1 PE=2 SV=4 1 353 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00580|GPA1_CRYPA Guanine nucleotide-binding protein subunit alpha OS=Cryphonectria parasitica PE=3 SV=3 1 353 0.0E+00
sp|O42784|GPA1_COLTR Guanine nucleotide-binding protein subunit alpha OS=Colletotrichum trifolii GN=CTG1 PE=2 SV=3 1 353 0.0E+00
sp|O13315|GPA1_MAGO7 Guanine nucleotide-binding protein subunit alpha OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MAGB PE=3 SV=4 1 353 0.0E+00
sp|Q05425|GPA1_NEUCR Guanine nucleotide-binding protein alpha-1 subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gna-1 PE=2 SV=1 1 353 0.0E+00
sp|O74259|GPA1_SPOS1 Guanine nucleotide-binding protein subunit alpha OS=Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) GN=SSG-1 PE=2 SV=4 1 353 0.0E+00
sp|O74227|GPA1_COCH4 Guanine nucleotide-binding protein subunit alpha OS=Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T) GN=CGA1 PE=3 SV=3 1 353 0.0E+00
sp|Q00743|GPA1_EMENI Guanine nucleotide-binding protein subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fadA PE=1 SV=3 1 353 0.0E+00
sp|P87032|GPA1_USTMA Guanine nucleotide-binding protein alpha-1 subunit OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GPA1 PE=3 SV=1 1 353 0.0E+00
sp|P30675|GPA1_COPCO Guanine nucleotide-binding protein subunit alpha OS=Coprinellus congregatus GN=CGP1 PE=2 SV=3 1 353 0.0E+00
sp|P04899|GNAI2_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Homo sapiens GN=GNAI2 PE=1 SV=3 1 352 6.0E-139
sp|P04897|GNAI2_RAT Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Rattus norvegicus GN=Gnai2 PE=1 SV=3 1 352 1.0E-138
sp|B2RSH2|GNAI1_MOUSE Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Mus musculus GN=Gnai1 PE=1 SV=1 1 352 1.0E-138
sp|P63096|GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Homo sapiens GN=GNAI1 PE=1 SV=2 1 352 1.0E-138
sp|P63097|GNAI1_BOVIN Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Bos taurus GN=GNAI1 PE=2 SV=2 1 352 1.0E-138
sp|P10824|GNAI1_RAT Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Rattus norvegicus GN=Gnai1 PE=1 SV=3 1 352 1.0E-138
sp|P38402|GNAI2_CAVPO Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Cavia porcellus GN=GNAI2 PE=2 SV=3 1 352 2.0E-138
sp|Q4R592|GNAI2_MACFA Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Macaca fascicularis GN=GNAI2 PE=2 SV=3 1 352 2.0E-138
sp|P38404|GNAO_LOCMI Guanine nucleotide-binding protein G(o) subunit alpha OS=Locusta migratoria PE=3 SV=1 1 352 3.0E-138
sp|P38400|GNAI2_CANLF Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Canis lupus familiaris GN=GNAI2 PE=2 SV=2 1 352 5.0E-138
sp|Q5RAD4|GNAI1_PONAB Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Pongo abelii GN=GNAI1 PE=2 SV=3 1 352 8.0E-138
sp|O13055|GNAI2_ORYLA Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Oryzias latipes GN=gnai2 PE=2 SV=3 1 352 8.0E-138
sp|P08754|GNAI3_HUMAN Guanine nucleotide-binding protein G(k) subunit alpha OS=Homo sapiens GN=GNAI3 PE=1 SV=3 1 352 1.0E-137
sp|P38401|GNAI1_CAVPO Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Cavia porcellus GN=GNAI1 PE=2 SV=3 1 352 2.0E-137
sp|P08752|GNAI2_MOUSE Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Mus musculus GN=Gnai2 PE=1 SV=5 1 352 2.0E-137
sp|P50147|GNAI2_CHICK Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Gallus gallus GN=GNAI2 PE=2 SV=2 1 352 2.0E-137
sp|P30683|GNAO_LYMST Guanine nucleotide-binding protein G(o) subunit alpha OS=Lymnaea stagnalis PE=2 SV=3 1 352 3.0E-137
sp|P51877|GNAO_PLATR Guanine nucleotide-binding protein G(o) subunit alpha OS=Planorbella trivolvis PE=2 SV=2 1 352 3.0E-137
sp|P30676|GNAI_PATPE Guanine nucleotide-binding protein G(i) subunit alpha OS=Patiria pectinifera PE=1 SV=3 1 352 6.0E-137
sp|P50146|GNAI1_CHICK Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Gallus gallus GN=GNAI1 PE=2 SV=2 1 352 6.0E-137
sp|P27044|GNAI1_XENLA Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Xenopus laevis GN=gnai1 PE=2 SV=3 1 352 4.0E-136
sp|P10825|GNAO_XENLA Guanine nucleotide-binding protein G(o) subunit alpha OS=Xenopus laevis GN=gna0 PE=2 SV=5 1 352 5.0E-136
sp|P87383|GNAI1_ORYLA Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Oryzias latipes GN=gnai1 PE=2 SV=3 1 352 9.0E-136
sp|Q9DC51|GNAI3_MOUSE Guanine nucleotide-binding protein G(k) subunit alpha OS=Mus musculus GN=Gnai3 PE=1 SV=3 1 352 3.0E-135
sp|P08753|GNAI3_RAT Guanine nucleotide-binding protein G(k) subunit alpha OS=Rattus norvegicus GN=Gnai3 PE=1 SV=3 1 352 3.0E-135
sp|P08239|GNAO_BOVIN Guanine nucleotide-binding protein G(o) subunit alpha OS=Bos taurus GN=GNAO1 PE=1 SV=4 1 352 5.0E-135
sp|P27045|GNAI3_XENLA Guanine nucleotide-binding protein G(k) subunit alpha (Fragment) OS=Xenopus laevis GN=gnai3 PE=2 SV=1 10 352 1.0E-134
sp|P30682|GNAI_LYMST Guanine nucleotide-binding protein G(i) subunit alpha OS=Lymnaea stagnalis PE=2 SV=3 1 352 2.0E-134
sp|P0C7Q4|GNAT3_BOVIN Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Bos taurus GN=GNAT3 PE=1 SV=1 1 352 2.0E-134
sp|P38403|GNAI3_CAVPO Guanine nucleotide-binding protein G(k) subunit alpha OS=Cavia porcellus GN=GNAI3 PE=2 SV=3 1 352 2.0E-134
sp|O15976|GNAO_MIZYE Guanine nucleotide-binding protein G(o) subunit alpha OS=Mizuhopecten yessoensis GN=SCGOA PE=2 SV=3 1 352 5.0E-134
sp|P51876|GNAI_PLATR Guanine nucleotide-binding protein G(i) subunit alpha OS=Planorbella trivolvis PE=2 SV=2 1 352 1.0E-133
sp|P59215|GNAO_RAT Guanine nucleotide-binding protein G(o) subunit alpha OS=Rattus norvegicus GN=Gnao1 PE=1 SV=2 1 352 1.0E-133
sp|P59216|GNAO_CRILO Guanine nucleotide-binding protein G(o) subunit alpha OS=Cricetulus longicaudatus GN=GNAO1 PE=2 SV=2 1 352 1.0E-133
sp|P09471|GNAO_HUMAN Guanine nucleotide-binding protein G(o) subunit alpha OS=Homo sapiens GN=GNAO1 PE=1 SV=4 1 352 2.0E-133
sp|P51875|GNAO_CAEEL Guanine nucleotide-binding protein G(o) subunit alpha OS=Caenorhabditis elegans GN=goa-1 PE=1 SV=3 1 352 2.0E-133
sp|P18872|GNAO_MOUSE Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus GN=Gnao1 PE=1 SV=3 1 352 3.0E-133
sp|P41776|GNAI_HOMAM Guanine nucleotide-binding protein G(i) subunit alpha OS=Homarus americanus PE=2 SV=2 1 352 9.0E-132
sp|P04696|GNAT2_BOVIN Guanine nucleotide-binding protein G(t) subunit alpha-2 OS=Bos taurus GN=GNAT2 PE=2 SV=3 1 352 2.0E-131
sp|P16378|GNAO_DROME G protein alpha o subunit OS=Drosophila melanogaster GN=Galphao PE=1 SV=1 1 352 2.0E-131
sp|P29348|GNAT3_RAT Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Rattus norvegicus GN=Gnat3 PE=1 SV=3 1 352 4.0E-131
sp|P20353|GNAI_DROME G protein alpha i subunit OS=Drosophila melanogaster GN=Galphai PE=1 SV=2 1 352 6.0E-131
sp|Q3V3I2|GNAT3_MOUSE Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Mus musculus GN=Gnat3 PE=1 SV=2 1 352 1.0E-130
sp|Q9N2V6|GPA16_CAEEL Guanine nucleotide-binding protein alpha-16 subunit OS=Caenorhabditis elegans GN=gpa-16 PE=1 SV=3 1 352 2.0E-130
sp|A8MTJ3|GNAT3_HUMAN Guanine nucleotide-binding protein G(t) subunit alpha-3 OS=Homo sapiens GN=GNAT3 PE=2 SV=2 1 352 4.0E-130
sp|P19087|GNAT2_HUMAN Guanine nucleotide-binding protein G(t) subunit alpha-2 OS=Homo sapiens GN=GNAT2 PE=2 SV=4 1 352 4.0E-130
sp|P50149|GNAT2_MOUSE Guanine nucleotide-binding protein G(t) subunit alpha-2 OS=Mus musculus GN=Gnat2 PE=2 SV=2 1 352 5.0E-130
sp|Q28300|GNAT1_CANLF Guanine nucleotide-binding protein G(t) subunit alpha-1 OS=Canis lupus familiaris GN=GNAT1 PE=2 SV=2 1 352 8.0E-130
sp|P20612|GNAT1_MOUSE Guanine nucleotide-binding protein G(t) subunit alpha-1 OS=Mus musculus GN=Gnat1 PE=1 SV=3 1 352 1.0E-129
sp|P04695|GNAT1_BOVIN Guanine nucleotide-binding protein G(t) subunit alpha-1 OS=Bos taurus GN=GNAT1 PE=1 SV=3 1 352 2.0E-129
sp|P11488|GNAT1_HUMAN Guanine nucleotide-binding protein G(t) subunit alpha-1 OS=Homo sapiens GN=GNAT1 PE=1 SV=5 1 352 3.0E-129
sp|P38407|GNAT_XENLA Guanine nucleotide-binding protein G(t) subunit alpha OS=Xenopus laevis GN=gnat PE=2 SV=2 1 352 2.0E-128
sp|Q60XS3|GPA16_CAEBR Guanine nucleotide-binding protein alpha-16 subunit OS=Caenorhabditis briggsae GN=gpa-16 PE=3 SV=3 1 352 5.0E-128
sp|Q18434|GPA17_CAEEL Guanine nucleotide-binding protein alpha-17 subunit OS=Caenorhabditis elegans GN=odr-3 PE=1 SV=1 1 353 1.0E-127
sp|Q86FX7|GPA17_CAEBR Guanine nucleotide-binding protein alpha-17 subunit OS=Caenorhabditis briggsae GN=odr-3 PE=3 SV=1 1 353 3.0E-127
sp|Q9BIG5|GPA4_CAEEL Guanine nucleotide-binding protein alpha-4 subunit OS=Caenorhabditis elegans GN=gpa-4 PE=2 SV=3 1 352 8.0E-126
sp|P28052|GPA3_CAEEL Guanine nucleotide-binding protein alpha-3 subunit OS=Caenorhabditis elegans GN=gpa-3 PE=1 SV=2 1 352 8.0E-124
sp|P53359|GNAO_MANSE Guanine nucleotide-binding protein G(o) subunit alpha OS=Manduca sexta PE=1 SV=2 1 352 6.0E-123
sp|Q60W52|GPA3_CAEBR Guanine nucleotide-binding protein alpha-3 subunit OS=Caenorhabditis briggsae GN=gpa-3 PE=3 SV=1 1 352 1.0E-121
sp|P21279|GNAQ_MOUSE Guanine nucleotide-binding protein G(q) subunit alpha OS=Mus musculus GN=Gnaq PE=1 SV=4 1 353 2.0E-121
sp|P82471|GNAQ_RAT Guanine nucleotide-binding protein G(q) subunit alpha OS=Rattus norvegicus GN=Gnaq PE=2 SV=2 1 353 2.0E-121
sp|Q2PKF4|GNAQ_PIG Guanine nucleotide-binding protein G(q) subunit alpha OS=Sus scrofa GN=GNAQ PE=2 SV=3 1 353 3.0E-121
sp|P50148|GNAQ_HUMAN Guanine nucleotide-binding protein G(q) subunit alpha OS=Homo sapiens GN=GNAQ PE=1 SV=4 1 353 3.0E-121
sp|Q28294|GNAQ_CANLF Guanine nucleotide-binding protein G(q) subunit alpha OS=Canis lupus familiaris GN=GNAQ PE=2 SV=2 1 353 3.0E-121
sp|O70443|GNAZ_MOUSE Guanine nucleotide-binding protein G(z) subunit alpha OS=Mus musculus GN=Gnaz PE=1 SV=4 1 352 6.0E-121
sp|Q61B55|GPA4_CAEBR Guanine nucleotide-binding protein alpha-4 subunit OS=Caenorhabditis briggsae GN=gpa-4 PE=3 SV=3 1 352 8.0E-121
sp|Q21917|GPA7_CAEEL Guanine nucleotide-binding protein alpha-7 subunit OS=Caenorhabditis elegans GN=gpa-7 PE=1 SV=1 1 352 2.0E-120
sp|P19627|GNAZ_RAT Guanine nucleotide-binding protein G(z) subunit alpha OS=Rattus norvegicus GN=Gnaz PE=2 SV=3 1 352 2.0E-120
sp|Q9XZV3|GNAO_GEOCY Guanine nucleotide-binding protein G(o) subunit alpha OS=Geodia cydonium PE=2 SV=3 2 353 6.0E-120
sp|Q61MQ8|GPA7_CAEBR Guanine nucleotide-binding protein alpha-7 subunit OS=Caenorhabditis briggsae GN=gpa-7 PE=3 SV=1 1 352 6.0E-120
sp|P19086|GNAZ_HUMAN Guanine nucleotide-binding protein G(z) subunit alpha OS=Homo sapiens GN=GNAZ PE=2 SV=3 1 352 5.0E-119
sp|P38410|GNAQ_XENLA Guanine nucleotide-binding protein G(q) subunit alpha OS=Xenopus laevis GN=gnaq PE=2 SV=2 1 353 5.0E-119
sp|P38412|GNAQ_LOLFO Guanine nucleotide-binding protein G(q) subunit alpha OS=Loligo forbesi PE=1 SV=1 1 353 5.0E-119
sp|P45645|GNA11_MELGA Guanine nucleotide-binding protein subunit alpha-11 OS=Meleagris gallopavo GN=GNA11 PE=1 SV=1 1 353 8.0E-119
sp|Q9HFW7|GPA3_NEUCR Guanine nucleotide-binding protein alpha-3 subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gna-3 PE=3 SV=1 1 353 1.0E-118
sp|P0CN96|GPA1_CRYNJ Guanine nucleotide-binding protein subunit alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GPA1 PE=3 SV=1 8 353 2.0E-118
sp|P0CN97|GPA1_CRYNB Guanine nucleotide-binding protein subunit alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GPA1 PE=3 SV=1 8 353 2.0E-118
sp|P43444|GNA11_XENLA Guanine nucleotide-binding protein subunit alpha-11 OS=Xenopus laevis GN=gna11 PE=2 SV=1 1 353 2.0E-118
sp|P29992|GNA11_HUMAN Guanine nucleotide-binding protein subunit alpha-11 OS=Homo sapiens GN=GNA11 PE=1 SV=2 1 353 2.0E-117
sp|Q2XSV9|GNA11_PIG Guanine nucleotide-binding protein subunit alpha-11 OS=Sus scrofa GN=GNA11 PE=2 SV=2 1 353 3.0E-117
sp|P38409|GNA11_BOVIN Guanine nucleotide-binding protein subunit alpha-11 OS=Bos taurus GN=GNA11 PE=2 SV=2 1 353 3.0E-117
sp|O95837|GNA14_HUMAN Guanine nucleotide-binding protein subunit alpha-14 OS=Homo sapiens GN=GNA14 PE=1 SV=1 3 353 5.0E-117
sp|P21278|GNA11_MOUSE Guanine nucleotide-binding protein subunit alpha-11 OS=Mus musculus GN=Gna11 PE=1 SV=1 1 353 8.0E-117
sp|Q05424|GPA2_NEUCR Guanine nucleotide-binding protein alpha-2 subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gna-2 PE=2 SV=1 4 348 1.0E-116
sp|P87033|GPA2_USTMA Guanine nucleotide-binding protein alpha-2 subunit OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GPA2 PE=3 SV=1 1 348 3.0E-116
sp|P16894|GPA1_DICDI Guanine nucleotide-binding protein alpha-1 subunit OS=Dictyostelium discoideum GN=gpaA PE=2 SV=1 16 353 4.0E-116
sp|Q9JID2|GNA11_RAT Guanine nucleotide-binding protein subunit alpha-11 OS=Rattus norvegicus GN=Gna11 PE=2 SV=1 1 353 5.0E-116
sp|P30677|GNA14_MOUSE Guanine nucleotide-binding protein subunit alpha-14 OS=Mus musculus GN=Gna14 PE=1 SV=2 3 353 9.0E-116
sp|P38408|GNA14_BOVIN Guanine nucleotide-binding protein subunit alpha-14 OS=Bos taurus GN=GNA14 PE=2 SV=1 3 353 1.0E-115
sp|O73819|GNA14_XENLA Guanine nucleotide-binding protein subunit alpha-14 OS=Xenopus laevis GN=gna14 PE=2 SV=1 2 353 1.0E-115
sp|P91950|GNAQ_HOMAM Guanine nucleotide-binding protein G(q) subunit alpha OS=Homarus americanus PE=2 SV=1 1 353 4.0E-115
sp|P38411|GNAQ_LYMST Guanine nucleotide-binding protein G(q) subunit alpha OS=Lymnaea stagnalis PE=2 SV=1 1 353 3.0E-114
sp|O14438|GPA3_USTHO Guanine nucleotide-binding protein alpha-3 subunit OS=Ustilago hordei GN=FIL1 PE=3 SV=1 1 353 5.0E-114
sp|P87034|GPA3_USTMA Guanine nucleotide-binding protein alpha-3 subunit OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GPA3 PE=1 SV=1 1 353 5.0E-114
sp|O15975|GNAQ_MIZYE Guanine nucleotide-binding protein G(q) subunit alpha OS=Mizuhopecten yessoensis GN=SCGQA PE=2 SV=1 1 353 8.0E-114
sp|P23625|GNAQ_DROME G protein alpha q subunit OS=Drosophila melanogaster GN=Galphaq PE=2 SV=2 1 348 6.0E-113
sp|P16051|GPA2_DICDI Guanine nucleotide-binding protein alpha-2 subunit OS=Dictyostelium discoideum GN=gpaB PE=1 SV=3 4 352 1.0E-110
sp|Q9XZV4|GNAQ_GEOCY Guanine nucleotide-binding protein G(q) subunit alpha OS=Geodia cydonium PE=2 SV=1 1 347 2.0E-109
sp|P22454|GPA2_CAEEL Guanine nucleotide-binding protein alpha-2 subunit OS=Caenorhabditis elegans GN=gpa-2 PE=2 SV=1 1 352 2.0E-97
sp|P34043|GPA5_DICDI Guanine nucleotide-binding protein alpha-5 subunit OS=Dictyostelium discoideum GN=gpaE PE=3 SV=2 1 344 6.0E-97
sp|P10823|GPA2_YEAST Guanine nucleotide-binding protein alpha-2 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPA2 PE=1 SV=2 33 353 4.0E-96
sp|P28051|GPA1_CAEEL Guanine nucleotide-binding protein alpha-1 subunit OS=Caenorhabditis elegans GN=gpa-1 PE=2 SV=2 1 352 2.0E-95
sp|P30679|GNA15_HUMAN Guanine nucleotide-binding protein subunit alpha-15 OS=Homo sapiens GN=GNA15 PE=1 SV=2 7 347 9.0E-95
sp|Q60MJ0|GPA1_CAEBR Guanine nucleotide-binding protein alpha-1 subunit OS=Caenorhabditis briggsae GN=gpa-1 PE=3 SV=1 1 352 2.0E-94
sp|P27584|GPA1_SCHPO Guanine nucleotide-binding protein alpha-1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpa1 PE=3 SV=4 12 348 4.0E-94
sp|O88302|GNA15_RAT Guanine nucleotide-binding protein subunit alpha-15 OS=Rattus norvegicus GN=Gna15 PE=2 SV=1 7 347 4.0E-94
sp|Q4VT35|GPA2_CAEBR Guanine nucleotide-binding protein alpha-2 subunit OS=Caenorhabditis briggsae GN=gpa-2 PE=3 SV=2 38 352 1.0E-93
sp|P91907|GPA15_CAEEL Guanine nucleotide-binding protein alpha-15 subunit OS=Caenorhabditis elegans GN=gpa-15 PE=2 SV=2 1 352 5.0E-93
sp|P54111|GPA2_KLULA Guanine nucleotide-binding protein alpha-2 subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPA2 PE=3 SV=2 32 353 1.0E-92
sp|P27601|GNA13_MOUSE Guanine nucleotide-binding protein subunit alpha-13 OS=Mus musculus GN=Gna13 PE=1 SV=1 2 348 1.0E-92
sp|Q6Q7Y5|GNA13_RAT Guanine nucleotide-binding protein subunit alpha-13 OS=Rattus norvegicus GN=Gna13 PE=1 SV=1 2 348 2.0E-92
sp|Q61DE0|GPA15_CAEBR Guanine nucleotide-binding protein alpha-15 subunit OS=Caenorhabditis briggsae GN=gpa-15 PE=3 SV=1 6 352 3.0E-92
sp|Q9TU29|GNA15_RABIT Guanine nucleotide-binding protein subunit alpha-15 OS=Oryctolagus cuniculus GN=GNA15 PE=2 SV=1 5 347 5.0E-92
sp|Q14344|GNA13_HUMAN Guanine nucleotide-binding protein subunit alpha-13 OS=Homo sapiens GN=GNA13 PE=1 SV=2 2 348 1.0E-91
sp|P34042|GPA4_DICDI Guanine nucleotide-binding protein alpha-4 subunit OS=Dictyostelium discoideum GN=gpaD PE=1 SV=1 11 347 3.0E-91
sp|P28868|GPA1_CANAW Guanine nucleotide-binding protein subunit alpha OS=Candida albicans (strain WO-1) GN=CAG1 PE=3 SV=5 123 353 4.0E-88
sp|P34044|GPA6_DICDI Guanine nucleotide-binding protein alpha-6 subunit OS=Dictyostelium discoideum GN=gpaF PE=2 SV=2 18 343 4.0E-88
sp|Q54R41|GPA9_DICDI Guanine nucleotide-binding protein alpha-9 subunit OS=Dictyostelium discoideum GN=gpaI PE=2 SV=1 1 349 1.0E-87
sp|Q9Y7B7|GPA1_KLULA Guanine nucleotide-binding protein alpha-1 subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPA1 PE=3 SV=4 122 353 1.0E-87
sp|P08539|GPA1_YEAST Guanine nucleotide-binding protein alpha-1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPA1 PE=1 SV=3 117 353 2.0E-87
sp|P27600|GNA12_MOUSE Guanine nucleotide-binding protein subunit alpha-12 OS=Mus musculus GN=Gna12 PE=1 SV=3 18 348 6.0E-87
sp|Q03113|GNA12_HUMAN Guanine nucleotide-binding protein subunit alpha-12 OS=Homo sapiens GN=GNA12 PE=1 SV=4 2 348 9.0E-87
sp|Q63210|GNA12_RAT Guanine nucleotide-binding protein subunit alpha-12 OS=Rattus norvegicus GN=Gna12 PE=1 SV=3 18 348 2.0E-86
sp|P30684|GNAS_LYMST Guanine nucleotide-binding protein G(s) subunit alpha OS=Lymnaea stagnalis PE=2 SV=1 1 348 6.0E-86
sp|P30678|GNA15_MOUSE Guanine nucleotide-binding protein subunit alpha-15 OS=Mus musculus GN=Gna15 PE=2 SV=1 7 347 1.0E-85
sp|P29797|GNAS_PIG Guanine nucleotide-binding protein G(s) subunit alpha OS=Sus scrofa GN=GNAS PE=2 SV=1 1 348 2.0E-85
sp|Q7PD79|GNAS_ANOGA Guanine nucleotide-binding protein G(s) subunit alpha OS=Anopheles gambiae GN=G-s-alpha-60A PE=2 SV=1 6 348 4.0E-85
sp|P24799|GNAS_XENLA Guanine nucleotide-binding protein G(s) subunit alpha OS=Xenopus laevis GN=gnas PE=2 SV=1 1 348 9.0E-84
sp|Q292P9|GNAS_DROPS Guanine nucleotide-binding protein G(s) subunit alpha OS=Drosophila pseudoobscura pseudoobscura GN=G-salpha60A PE=3 SV=1 6 348 5.0E-83
sp|O16118|GNAS_HOMAM Guanine nucleotide-binding protein G(s) subunit alpha OS=Homarus americanus PE=2 SV=1 1 348 7.0E-83
sp|P63091|GNAS_CANLF Guanine nucleotide-binding protein G(s) subunit alpha OS=Canis lupus familiaris GN=GNAS PE=2 SV=1 1 348 2.0E-82
sp|P63092|GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Homo sapiens GN=GNAS PE=1 SV=1 1 348 2.0E-82
sp|P20354|GNAS_DROME G protein alpha s subunit OS=Drosophila melanogaster GN=Galphas PE=2 SV=1 6 348 2.0E-82
sp|P04896|GNAS2_BOVIN Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Bos taurus GN=GNAS PE=1 SV=1 1 348 2.0E-82
sp|P63093|GNAS_MESAU Guanine nucleotide-binding protein G(s) subunit alpha OS=Mesocricetus auratus GN=GNAS PE=2 SV=1 1 348 2.0E-82
sp|P63095|GNAS2_RAT Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Rattus norvegicus GN=Gnas PE=1 SV=1 1 348 2.0E-82
sp|P63094|GNAS2_MOUSE Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Mus musculus GN=Gnas PE=1 SV=1 1 348 2.0E-82
sp|P16052|GNAS_CRILO Guanine nucleotide-binding protein G(s) subunit alpha OS=Cricetulus longicaudatus GN=GNAS PE=2 SV=1 1 348 3.0E-82
sp|Q8R4A8|GNAS_CRIGR Guanine nucleotide-binding protein G(s) subunit alpha OS=Cricetulus griseus GN=GNAS PE=2 SV=1 1 348 3.0E-82
sp|Q04665|GPA2_SCHPO Guanine nucleotide-binding protein alpha-2 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpa2 PE=1 SV=1 7 352 5.0E-82
sp|Q19572|GPA12_CAEEL Guanine nucleotide-binding protein alpha-12 subunit OS=Caenorhabditis elegans GN=gpa-12 PE=1 SV=2 15 348 2.0E-81
sp|Q613V4|GPA12_CAEBR Guanine nucleotide-binding protein alpha-12 subunit OS=Caenorhabditis briggsae GN=gpa-12 PE=3 SV=1 15 348 3.0E-81
sp|Q20907|GPA8_CAEEL Guanine nucleotide-binding protein alpha-8 subunit OS=Caenorhabditis elegans GN=gpa-8 PE=2 SV=1 8 352 5.0E-81
sp|P34046|GPA8_DICDI Guanine nucleotide-binding protein alpha-8 subunit OS=Dictyostelium discoideum GN=gpaH PE=2 SV=2 1 349 5.0E-79
sp|Q61MC6|GPA8_CAEBR Guanine nucleotide-binding protein alpha-8 subunit OS=Caenorhabditis briggsae GN=gpa-8 PE=3 SV=1 15 352 5.0E-79
sp|Q9BIG4|GPA10_CAEEL Guanine nucleotide-binding protein alpha-10 subunit OS=Caenorhabditis elegans GN=gpa-10 PE=2 SV=1 5 353 6.0E-78
sp|Q8CGK7|GNAL_MOUSE Guanine nucleotide-binding protein G(olf) subunit alpha OS=Mus musculus GN=Gnal PE=1 SV=1 1 348 1.0E-77
sp|P38405|GNAL_HUMAN Guanine nucleotide-binding protein G(olf) subunit alpha OS=Homo sapiens GN=GNAL PE=1 SV=1 1 348 2.0E-77
sp|Q6R0H7|GNAS1_MOUSE Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Mus musculus GN=Gnas PE=1 SV=1 5 348 2.0E-77
sp|P38406|GNAL_RAT Guanine nucleotide-binding protein G(olf) subunit alpha OS=Rattus norvegicus GN=Gnal PE=2 SV=2 1 348 5.0E-77
sp|P30669|GNAS_SCHMA Guanine nucleotide-binding protein G(s) subunit alpha OS=Schistosoma mansoni PE=2 SV=1 3 348 2.0E-76
sp|O76584|GPA11_CAEEL Guanine nucleotide-binding protein alpha-11 subunit OS=Caenorhabditis elegans GN=gpa-11 PE=2 SV=2 15 353 2.0E-76
sp|Q63803|GNAS1_RAT Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Rattus norvegicus GN=Gnas PE=1 SV=3 5 348 2.0E-76
sp|Q93743|GPA6_CAEEL Guanine nucleotide-binding protein alpha-6 subunit OS=Caenorhabditis elegans GN=gpa-6 PE=2 SV=2 2 352 4.0E-76
sp|Q9XZV5|GNAS_GEOCY Guanine nucleotide-binding protein G(s) subunit alpha OS=Geodia cydonium PE=2 SV=1 1 348 1.0E-75
sp|Q4VT31|GPA6_CAEBR Guanine nucleotide-binding protein alpha-6 subunit OS=Caenorhabditis briggsae GN=gpa-6 PE=3 SV=2 2 352 9.0E-74
sp|Q5JWF2|GNAS1_HUMAN Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Homo sapiens GN=GNAS PE=1 SV=2 13 348 1.0E-72
sp|P34045|GPA7_DICDI Guanine nucleotide-binding protein alpha-7 subunit OS=Dictyostelium discoideum GN=gpaG PE=2 SV=3 1 352 3.0E-72
sp|Q4VT42|GPA10_CAEBR Guanine nucleotide-binding protein alpha-10 subunit OS=Caenorhabditis briggsae GN=gpa-10 PE=3 SV=2 2 353 2.0E-71
sp|P25157|GNAL_DROME Guanine nucleotide-binding protein subunit alpha homolog OS=Drosophila melanogaster GN=cta PE=2 SV=1 6 347 2.0E-69
sp|Q20910|GPA9_CAEEL Guanine nucleotide-binding protein alpha-9 subunit OS=Caenorhabditis elegans GN=gpa-9 PE=3 SV=3 16 352 3.0E-68
sp|Q0DJ33|GPA1_ORYSJ Guanine nucleotide-binding protein alpha-1 subunit OS=Oryza sativa subsp. japonica GN=GPA1 PE=1 SV=2 14 316 1.0E-64
sp|A2Y3B5|GPA1_ORYSI Guanine nucleotide-binding protein alpha-1 subunit OS=Oryza sativa subsp. indica GN=GPA1 PE=2 SV=2 14 316 1.0E-64
sp|O04279|GPA2_PEA Guanine nucleotide-binding protein alpha-2 subunit OS=Pisum sativum GN=GPA2 PE=2 SV=1 11 353 1.0E-64
sp|O04278|GPA1_PEA Guanine nucleotide-binding protein alpha-1 subunit OS=Pisum sativum GN=GPA1 PE=2 SV=1 11 353 1.0E-64
sp|Q54KV6|GPA3_DICDI Guanine nucleotide-binding protein alpha-3 subunit OS=Dictyostelium discoideum GN=gpaC PE=3 SV=1 119 349 3.0E-64
sp|P26981|GPA1_SOLLC Guanine nucleotide-binding protein alpha-1 subunit OS=Solanum lycopersicum GN=GPA1 PE=2 SV=1 6 353 3.0E-64
sp|P18064|GPA1_ARATH Guanine nucleotide-binding protein alpha-1 subunit OS=Arabidopsis thaliana GN=GPA1 PE=1 SV=1 7 353 3.0E-64
sp|Q40224|GPA1_LUPLU Guanine nucleotide-binding protein alpha-1 subunit OS=Lupinus luteus GN=GPA1 PE=2 SV=1 11 353 5.0E-64
sp|P52206|GNA11_CANLF Guanine nucleotide-binding protein subunit alpha-11 (Fragment) OS=Canis lupus familiaris GN=GNA11 PE=2 SV=1 38 236 1.0E-63
sp|P93163|GPA2_SOYBN Guanine nucleotide-binding protein alpha-2 subunit OS=Glycine max GN=GPA2 PE=2 SV=1 11 353 2.0E-63
sp|P49082|GPA1_LOTJA Guanine nucleotide-binding protein alpha-1 subunit OS=Lotus japonicus GN=GPA1 PE=2 SV=1 11 353 2.0E-63
sp|Q05337|GNAF_DROME Guanine nucleotide-binding protein G(f) subunit alpha OS=Drosophila melanogaster GN=Galphaf PE=2 SV=1 27 352 3.0E-63
sp|P49084|GPA1_SOYBN Guanine nucleotide-binding protein alpha-1 subunit OS=Glycine max GN=GPA1 PE=2 SV=1 11 283 3.0E-62
sp|P93564|GPA1_SOLTU Guanine nucleotide-binding protein alpha-1 subunit OS=Solanum tuberosum GN=GPA1 PE=2 SV=1 19 353 3.0E-62
sp|Q4VT39|GPA13_CAEBR Guanine nucleotide-binding protein alpha-13 subunit OS=Caenorhabditis briggsae GN=gpa-13 PE=3 SV=1 1 338 7.0E-59
sp|Q54VG1|GPA12_DICDI Guanine nucleotide-binding protein alpha-12 subunit OS=Dictyostelium discoideum GN=gpaL PE=1 SV=1 40 338 8.0E-59
sp|Q9XTB2|GPA13_CAEEL Guanine nucleotide-binding protein alpha-13 subunit OS=Caenorhabditis elegans GN=gpa-13 PE=1 SV=2 1 331 2.0E-58
sp|Q4VT38|GPA14_CAEBR Guanine nucleotide-binding protein alpha-14 subunit OS=Caenorhabditis briggsae GN=gpa-14 PE=3 SV=2 7 352 7.0E-58
sp|Q9BIG2|GPA14_CAEEL Guanine nucleotide-binding protein alpha-14 subunit OS=Caenorhabditis elegans GN=gpa-14 PE=1 SV=2 7 352 1.0E-52
sp|Q86D96|GPA1_TRIVA Guanine nucleotide-binding protein subunit alpha-1 OS=Trichomonas vaginalis GN=GA1 PE=3 SV=1 36 308 3.0E-48
sp|P87035|GPA4_USTMA Guanine nucleotide-binding protein alpha-4 subunit OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GPA4 PE=3 SV=1 129 353 6.0E-46
sp|Q619V5|GPA5_CAEBR Guanine nucleotide-binding protein alpha-5 subunit OS=Caenorhabditis briggsae GN=gpa-5 PE=3 SV=1 1 352 9.0E-45
sp|Q20701|GPA5_CAEEL Guanine nucleotide-binding protein alpha-5 subunit OS=Caenorhabditis elegans GN=gpa-5 PE=2 SV=1 1 346 3.0E-41
sp|Q55EP5|GPA10_DICDI Guanine nucleotide-binding protein-like alpha-10 subunit OS=Dictyostelium discoideum GN=gpaJ PE=3 SV=1 18 343 4.0E-35
sp|Q8T130|GPA11_DICDI Guanine nucleotide-binding protein-like alpha-11 subunit OS=Dictyostelium discoideum GN=gpaK PE=3 SV=1 34 333 3.0E-27
sp|P43151|GPA_LEIDO Putative guanine nucleotide-binding protein subunit alpha OS=Leishmania donovani PE=2 SV=1 13 205 3.0E-27
sp|O15743|SPNA_DICDI Protein spalten OS=Dictyostelium discoideum GN=spnA PE=1 SV=1 36 332 4.0E-26
sp|O80462|XLG1_ARATH Extra-large guanine nucleotide-binding protein 1 OS=Arabidopsis thaliana GN=XLG1 PE=1 SV=2 26 290 8.0E-21
sp|P08539|GPA1_YEAST Guanine nucleotide-binding protein alpha-1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPA1 PE=1 SV=3 1 96 1.0E-18
sp|Q9C516|XLG3_ARATH Extra-large guanine nucleotide-binding protein 3 OS=Arabidopsis thaliana GN=XLG3 PE=1 SV=1 35 290 1.0E-18
sp|Q9Y7B7|GPA1_KLULA Guanine nucleotide-binding protein alpha-1 subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPA1 PE=3 SV=4 1 103 2.0E-17
sp|P28868|GPA1_CANAW Guanine nucleotide-binding protein subunit alpha OS=Candida albicans (strain WO-1) GN=CAG1 PE=3 SV=5 1 96 4.0E-16
sp|C6KIE6|XLG2_ARATH Extra-large guanine nucleotide-binding protein 2 OS=Arabidopsis thaliana GN=XLG2 PE=1 SV=1 35 290 1.0E-13
sp|Q60397|GNAI3_CRIGR Guanine nucleotide-binding protein G(k) subunit alpha (Fragment) OS=Cricetulus griseus GN=GNAI3 PE=3 SV=1 292 352 2.0E-12
sp|Q54KV6|GPA3_DICDI Guanine nucleotide-binding protein alpha-3 subunit OS=Dictyostelium discoideum GN=gpaC PE=3 SV=1 15 96 6.0E-11
sp|P87035|GPA4_USTMA Guanine nucleotide-binding protein alpha-4 subunit OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GPA4 PE=3 SV=1 35 101 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003924 GTPase activity Yes
GO:0019001 guanyl nucleotide binding Yes
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0005525 GTP binding Yes
GO:0031683 G-protein beta/gamma-subunit complex binding Yes
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0032555 purine ribonucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0007165 signal transduction No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No
GO:0043168 anion binding No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0097367 carbohydrate derivative binding No
GO:0050789 regulation of biological process No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0044877 protein-containing complex binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1055
MGCGMSTEEKEGKARNEEIENQLKRDKMMQRNEIKMLLLGAGESGKSTILKQMKLIHEGGYSRDERESFKEIIFS
NTVQSMRVILEAMESLELPLEDQRMEYHVQTIFMQPTQIEGDVLPPEVGGAIEALWKDRGVQECFKRSREYQLND
SARYYFDNISRIATPDYMPNDQDVLRSRVKTTGITETTFIIGDLTYRMFDVGGQRSERKKWIHCFENVTTILFLV
AISEYDQLLFEDETVNRMQEALTLFDSICNSRWFIKTSIILFLNKIDRFKEKLPVSPMKNYFPDYEGGDDYAAAC
DYILNRFVSLNQHETKQIYTHFTCATDTTQIRFVMAAVNDIIIQENLRLCGLI
Coding >Ophio5|1055
ATGGGTTGTGGAATGAGCACGGAGGAGAAGGAGGGCAAGGCCCGTAACGAGGAGATCGAGAATCAGCTGAAGCGC
GACAAGATGATGCAGCGCAACGAGATCAAGATGCTCCTACTGGGTGCCGGTGAATCTGGCAAGTCCACCATCCTC
AAGCAGATGAAGCTCATCCACGAGGGTGGCTATTCTCGAGACGAACGGGAATCCTTCAAGGAAATCATCTTCAGC
AACACTGTTCAATCGATGCGCGTAATCCTCGAGGCCATGGAGTCGCTCGAACTGCCGTTGGAGGACCAACGCATG
GAGTATCACGTTCAGACCATCTTCATGCAGCCAACACAGATTGAAGGCGACGTGCTGCCTCCGGAAGTCGGCGGC
GCCATCGAGGCTCTGTGGAAGGATCGCGGCGTTCAGGAGTGCTTCAAGCGATCTCGCGAATATCAGTTGAATGAC
TCGGCGCGATACTATTTTGACAATATCAGTCGCATTGCCACCCCCGACTATATGCCGAACGACCAGGATGTACTC
CGGTCGCGCGTTAAGACGACGGGCATCACAGAGACGACGTTCATTATTGGTGATCTCACCTACCGCATGTTCGAC
GTTGGAGGGCAGCGATCGGAGCGCAAGAAGTGGATTCACTGTTTCGAAAACGTTACCACCATCCTCTTCCTTGTC
GCCATCTCCGAGTACGACCAGCTGCTGTTCGAGGACGAGACGGTCAACCGCATGCAAGAGGCCCTGACATTGTTC
GATTCCATCTGTAACTCTCGATGGTTCATTAAGACGTCCATCATTTTATTCCTCAACAAGATCGACCGTTTTAAG
GAGAAGCTGCCTGTCAGCCCGATGAAGAATTATTTCCCCGACTATGAAGGAGGCGATGACTACGCAGCGGCCTGC
GATTACATCCTCAACCGATTCGTCAGCCTCAACCAGCACGAGACGAAGCAGATTTATACGCATTTTACATGTGCC
ACCGACACGACCCAAATCCGATTCGTCATGGCCGCAGTCAATGACATCATCATACAAGAAAATCTGAGATTGTGC
GGTCTCATC
Transcript >Ophio5|1055
ATGGGTTGTGGAATGAGCACGGAGGAGAAGGAGGGCAAGGCCCGTAACGAGGAGATCGAGAATCAGCTGAAGCGC
GACAAGATGATGCAGCGCAACGAGATCAAGATGCTCCTACTGGGTGCCGGTGAATCTGGCAAGTCCACCATCCTC
AAGCAGATGAAGCTCATCCACGAGGGTGGCTATTCTCGAGACGAACGGGAATCCTTCAAGGAAATCATCTTCAGC
AACACTGTTCAATCGATGCGCGTAATCCTCGAGGCCATGGAGTCGCTCGAACTGCCGTTGGAGGACCAACGCATG
GAGTATCACGTTCAGACCATCTTCATGCAGCCAACACAGATTGAAGGCGACGTGCTGCCTCCGGAAGTCGGCGGC
GCCATCGAGGCTCTGTGGAAGGATCGCGGCGTTCAGGAGTGCTTCAAGCGATCTCGCGAATATCAGTTGAATGAC
TCGGCGCGATACTATTTTGACAATATCAGTCGCATTGCCACCCCCGACTATATGCCGAACGACCAGGATGTACTC
CGGTCGCGCGTTAAGACGACGGGCATCACAGAGACGACGTTCATTATTGGTGATCTCACCTACCGCATGTTCGAC
GTTGGAGGGCAGCGATCGGAGCGCAAGAAGTGGATTCACTGTTTCGAAAACGTTACCACCATCCTCTTCCTTGTC
GCCATCTCCGAGTACGACCAGCTGCTGTTCGAGGACGAGACGGTCAACCGCATGCAAGAGGCCCTGACATTGTTC
GATTCCATCTGTAACTCTCGATGGTTCATTAAGACGTCCATCATTTTATTCCTCAACAAGATCGACCGTTTTAAG
GAGAAGCTGCCTGTCAGCCCGATGAAGAATTATTTCCCCGACTATGAAGGAGGCGATGACTACGCAGCGGCCTGC
GATTACATCCTCAACCGATTCGTCAGCCTCAACCAGCACGAGACGAAGCAGATTTATACGCATTTTACATGTGCC
ACCGACACGACCCAAATCCGATTCGTCATGGCCGCAGTCAATGACATCATCATACAAGAAAATCTGAGATTGTGC
GGTCTCATCTAA
Gene >Ophio5|1055
ATGGGTTGTGGAATGAGCACGGAGGAGAAGGAGGGCAAGGCCCGTAACGAGGAGATCGAGAATCAGCTGAAGCGC
GACAAGATGATGCAGCGCAACGAGATCAAGATGCTCCTACTGGGTATGTCGCCCGCGCGCACCTTTTTCTCTTCT
TGACTCTTCGTCGCCGGCTTGGCGCTTACTGACTCGGCCGTCAAGGTGCCGGTGAATCTGGCAAGTCCACCATCC
TCAAGCAGATGAAGCTCATCCACGAGGGTGGCTATTCTCGAGACGAACGGGAATCCTTCAAGGAAATCATCTTCA
GCAACACTGTTCAATCGATGCGCGTAATCCTCGAGGCCATGGAGTCGCTCGAACTGCCGTTGGAGGACCAACGCA
TGGAGTATCACGTTCAGACCATCTTCATGCAGCCAACACAGATTGAAGGCGACGTGCTGCCTCCGGAAGTCGGCG
GCGCCATCGAGGCTCTGTGGAAGGATCGCGGCGTTCAGGAGTGCTTCAAGCGATCTCGCGAATATCAGTTGAATG
ACTCGGCGCGATAGTGAGTCGCGCCACGTCCTCCTTATCTTCTCCTTAGCTCTGCTGACTGGCCTCCAGCTATTT
TGACAATATCAGTCGCATTGCCACCCCCGACTATATGCCGAACGACCAGGATGTACTCCGGTCGCGCGTTAAGAC
GACGGGCATCACAGAGACGACGTTCATTATTGGTGATCTCACCTACCGCATGTTCGACGTTGGAGGGCAGCGATC
GGAGCGCAAGAAGTGGATTCACTGTTTCGAAAACGTTACCACCATCCTCTTCCTTGTCGCCATCTCCGAGTACGA
CCAGCTGCTGTTCGAGGACGAGACGGTCAACCGCATGCAAGAGGCCCTGACATTGTTCGATTCCATCTGTAACTC
TCGATGGTTCATTAAGACGTCCATCATTTTATTCCTCAACAAGATCGACCGTTTTAAGGAGAAGCTGCCTGTCAG
CCCGATGAAGAATTATTTCCCCGACTATGAAGGAGGCGATGACTACGCAGCGGCCTGCGATTACATCCTCAACCG
ATTCGTCAGCCTCAACCAGCACGAGACGAAGCAGATTTATACGCATTTTACATGTGCCACCGACACGACCCAAAT
CCGATTCGTCATGGCCGCAGTCAATGGTGAGTCCTGTTTCATCCTACCCTGGGAGCCACGTGCGCTGCTCTTGAG
GTTGGGAGGAGTATTTGGAGCGAAAGAATCAAGACTAATGGATTCCCAGACATCATCATACAAGAAAATCTGAGA
TTGTGCGGTCTCATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail