Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1052
Gene name
Locationscaffold_132:14765..15317
Strand-
Gene length (bp)552
Transcript length (bp)495
Coding sequence length (bp)492
Protein length (aa) 164

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08312 cwf21 cwf21 domain 6.3E-16 54 95

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB70|CWC21_GIBZE Pre-mRNA-splicing factor CWC21 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CWC21 PE=3 SV=1 1 162 2.0E-79
sp|Q7RYH7|CWC21_NEUCR Pre-mRNA-splicing factor cwc-21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cwc-21 PE=3 SV=1 1 160 8.0E-64
sp|P0CM94|CWC21_CRYNJ Pre-mRNA-splicing factor CWC21 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC21 PE=3 SV=1 1 150 5.0E-32
sp|P0CM95|CWC21_CRYNB Pre-mRNA-splicing factor CWC21 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC21 PE=3 SV=1 1 150 5.0E-32
sp|Q4WDD0|CWC21_ASPFU Pre-mRNA-splicing factor cwc21 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc21 PE=3 SV=1 1 142 4.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB70|CWC21_GIBZE Pre-mRNA-splicing factor CWC21 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CWC21 PE=3 SV=1 1 162 2.0E-79
sp|Q7RYH7|CWC21_NEUCR Pre-mRNA-splicing factor cwc-21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cwc-21 PE=3 SV=1 1 160 8.0E-64
sp|P0CM94|CWC21_CRYNJ Pre-mRNA-splicing factor CWC21 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC21 PE=3 SV=1 1 150 5.0E-32
sp|P0CM95|CWC21_CRYNB Pre-mRNA-splicing factor CWC21 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC21 PE=3 SV=1 1 150 5.0E-32
sp|Q4WDD0|CWC21_ASPFU Pre-mRNA-splicing factor cwc21 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc21 PE=3 SV=1 1 142 4.0E-29
sp|Q4P0G6|CWC21_USTMA Pre-mRNA-splicing factor CWC21 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC21 PE=3 SV=1 1 147 2.0E-18
sp|Q751G9|CWC21_ASHGO Pre-mRNA-splicing factor CWC21 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CWC21 PE=3 SV=1 3 98 1.0E-15
sp|Q8BTI8|SRRM2_MOUSE Serine/arginine repetitive matrix protein 2 OS=Mus musculus GN=Srrm2 PE=1 SV=3 1 155 8.0E-15
sp|Q9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein 2 OS=Homo sapiens GN=SRRM2 PE=1 SV=2 1 155 1.0E-14
sp|Q6BWB8|CWC21_DEBHA Pre-mRNA-splicing factor CWC21 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CWC21 PE=3 SV=1 2 94 1.0E-11
sp|Q5AP89|CWC21_CANAL Pre-mRNA-splicing factor CWC21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CWC21 PE=3 SV=1 1 95 3.0E-11
sp|O14161|CWC21_SCHPO Pre-mRNA-splicing factor cwf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf21 PE=1 SV=2 1 76 1.0E-10
sp|Q6CVR3|CWC21_KLULA Pre-mRNA-splicing factor CWC21 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CWC21 PE=3 SV=2 3 103 2.0E-08
sp|Q6FRM6|CWC21_CANGA Pre-mRNA-splicing factor CWC21 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CWC21 PE=3 SV=1 1 97 4.0E-08
sp|Q6C0M9|CWC21_YARLI Pre-mRNA-splicing factor CWC21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC21 PE=3 SV=1 1 73 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1052
MSDNVGLSTPRGSGTSGYVQRNLAQVKPRDYGAPYPKDLDSLRYKQRQPDKGILEHDRKRQIEVKVFDLRDQLEE
DDVAEEEIERRCDELRKKLDAESENARNSGPRKAFKEHQVHEMADAKIKESERLRRALKISSDYKEGSYWDRQAD
RMRDAVKDDAKDKH
Coding >Ophio5|1052
ATGTCGGACAACGTTGGGCTCTCCACGCCGCGCGGCAGCGGAACGTCCGGCTACGTCCAGCGCAATCTGGCGCAA
GTCAAGCCCCGCGACTACGGCGCGCCCTATCCGAAAGACCTTGACAGCTTGCGGTACAAGCAGCGGCAGCCGGAC
AAGGGAATTCTCGAGCACGACCGCAAGCGTCAGATCGAAGTCAAGGTGTTTGACTTACGCGATCAGCTGGAAGAG
GACGACGTCGCAGAGGAGGAGATCGAACGTCGTTGCGATGAGCTCCGGAAGAAACTCGACGCCGAGTCCGAAAAC
GCCAGGAATAGCGGCCCACGGAAGGCCTTTAAAGAGCACCAGGTTCATGAGATGGCGGATGCCAAGATCAAAGAG
AGCGAGCGTCTGAGGCGAGCGCTGAAGATAAGCTCCGACTACAAGGAGGGCAGCTATTGGGATAGGCAAGCGGAT
AGGATGCGTGACGCCGTCAAGGACGACGCGAAAGACAAGCAT
Transcript >Ophio5|1052
ATGTCGGACAACGTTGGGCTCTCCACGCCGCGCGGCAGCGGAACGTCCGGCTACGTCCAGCGCAATCTGGCGCAA
GTCAAGCCCCGCGACTACGGCGCGCCCTATCCGAAAGACCTTGACAGCTTGCGGTACAAGCAGCGGCAGCCGGAC
AAGGGAATTCTCGAGCACGACCGCAAGCGTCAGATCGAAGTCAAGGTGTTTGACTTACGCGATCAGCTGGAAGAG
GACGACGTCGCAGAGGAGGAGATCGAACGTCGTTGCGATGAGCTCCGGAAGAAACTCGACGCCGAGTCCGAAAAC
GCCAGGAATAGCGGCCCACGGAAGGCCTTTAAAGAGCACCAGGTTCATGAGATGGCGGATGCCAAGATCAAAGAG
AGCGAGCGTCTGAGGCGAGCGCTGAAGATAAGCTCCGACTACAAGGAGGGCAGCTATTGGGATAGGCAAGCGGAT
AGGATGCGTGACGCCGTCAAGGACGACGCGAAAGACAAGCATTAG
Gene >Ophio5|1052
ATGTCGGACAACGTTGGGCTCTCCACGCCGCGCGGCAGCGGAACGTCCGGCTACGTCCAGCGCAATCTGGCGCAA
GTCAAGCCCCGCGACTACGGCGCGCCCTATCCGAAAGACCTTGACAGCTTGCGGTACAAGCAGCGGCAGCCGGAC
AAGGGAATTCTCGAGCACGACCGCAAGCGTCAGATCGAAGTCAAGGTGTTTGACTTACGCGATCAGCTGGAAGAG
GACGAGTATGGAGACGCCCTCGTCGCCGTGGAAGCGCTTGCTGACTTGAATCCCTTTCTCAGCGTCGCAGAGGAG
GAGATCGAACGTCGTTGCGATGAGCTCCGGAAGAAACTCGACGCCGAGTCCGAAAACGCCAGGAATAGCGGCCCA
CGGAAGGCCTTTAAAGAGCACCAGGTTCATGAGATGGCGGATGCCAAGATCAAAGAGAGCGAGCGTCTGAGGCGA
GCGCTGAAGATAAGCTCCGACTACAAGGAGGGCAGCTATTGGGATAGGCAAGCGGATAGGATGCGTGACGCCGTC
AAGGACGACGCGAAAGACAAGCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail