Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1048
Gene name
Locationscaffold_132:1980..7603
Strand-
Gene length (bp)5623
Transcript length (bp)5466
Coding sequence length (bp)5463
Protein length (aa) 1821

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18378 Nup188_C Nuclear pore protein NUP188 C-terminal domain 1.4E-154 1452 1815
PF10487 Nup188 Nucleoporin subcomplex protein binding to Pom34 2.6E-07 97 434
PF10487 Nup188 Nucleoporin subcomplex protein binding to Pom34 1.0E-32 614 1150

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G0SFH5|NU188_CHATD Nucleoporin NUP188 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP188 PE=1 SV=1 1 1814 0.0E+00
sp|Q9P7M8|NU184_SCHPO Nucleoporin nup184 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup184 PE=4 SV=1 593 1705 3.0E-41
sp|P52593|NU188_YEAST Nucleoporin NUP188 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP188 PE=1 SV=1 814 1697 5.0E-26

GO

GO Term Description Terminal node
GO:0017056 structural constituent of nuclear pore Yes
GO:0005198 structural molecule activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.5533 0.6141 0.1017 0.0432 0.0583 0.013 0.402 0.1156 0.28 0.0156

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4494
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3831
Ophiocordyceps australis map64 (Brazil) OphauB2|6760
Ophiocordyceps camponoti-floridani Ophcf2|01274
Ophiocordyceps camponoti-rufipedis Ophun1|793
Ophiocordyceps kimflemingae Ophio5|1048 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9374

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1048
MAPVSDSNYFPSLEDCLSGDRLLLSWKDVSIALSDESGHRQSSSALQSFLSDEFILALLNDPSKAFAPPDEASKV
DFDTKTAPINVASASTDGFDIKTIKSDAEWLSKNARVNLVAALRVVLIEMQSRPRRHLTGPLSSQDASNLQEAAG
LQNSQGACFLYDLGAASTLDVDEITADFDKPDSRKRRLFDTFLTERRSFMMTMEYLFSLQLYRRLPILTSADRGL
ATLYRLQPMADNMASLLPAYLKVVCDCMGGIEEGLGSLTDDALLLLQEVELDWIRSLLTETIHALSVAFQLVDSL
GSEFPPSDAVNQWFSLMEVYGFFGSVQPIHPAIAELIPPLRALSCAVSLSLLKPLRSLTFLSEREEDPALPDDSY
DAFLLSSDVLEQIHKSIINVAGADCEDATPVIFAWTLLLHRMIVSYQNRTEKRDNLQQQRSQDTFEGVMRPTAPR
RNSAGSIFSIESSKFDGFLENATGLKDMQLVEQLAAGVTAHGRVFDAIAGMATSLGPSADGSMTLLISSRIRVVF
LELLKVSYPIVGYQSEPLGSLFSILAPGHGYWDLTSSEDQLSPAQDVVPCMLHDDHAMEFYFQPALDRFPYEFLP
FITFCRTFCAATANLDDDRSDLILDLLRKTPSLTFTLPDDFSGYELVQEDENTNSFCLLQEIPLISLSSSWSRRY
IEDDAYRLPSGTYGRFVTDSGRVVVVDYPHSTLSMLGRQLEINLAKEGYHSELGMLQPDDVAEVIFLLSTLLRAE
HLKADKMSEGNALIHEESDFLLEAGRHISGGKDLVTVICETMDHFMQDELAMADDVAVRVLSACVTFLDAILPVQ
PNRVWSYLARSELLGSEARAGKLAKITGTLDLVSGRFDLLMSSLYFFSRLVDTVMCSGVRRRAGNKLAGRQKQDS
NQWPGTADRVLTWVSLSIAQASIDIMESTSTWRFDSETGRLLVLSKVVPVLDKLVLYSYSMGESPGSDNLTSCLR
PAASYVVDCFMSPATGTLRYGPILSSLGAAFASSDCTLYPRRTAIVQNQACSVLGFCTTLLRAADYLGRSSAMLE
AYLFKSSTLLARLSASPRQVRIPVIRLLESLVVSAGKSAGEPPSLLGYLGPQISKSFLQSLSHLGKPFALTQEVK
TTWSFFSAILRNRQQWMSNCLLTGQTPREAMKEGGKKGELAADSVFVHALTKLKQLKDVESVEALAVLDFVASAQ
NYWPWTIFTLLKDTSYIDGLRAYVRELRPSQWTSKSDTIGTSLNARKAAYVAETLAMQLYHARHQGTAKELAQSL
VADLDYYIRDGVEAAGYNKSLHNNFAKNFASKYFGCSLDLFKRTPLEPRELGENYYYDMERADDMLKFDPGWLGR
KGDGFKNEMELANANLSLVDAQIALFHAWEFLLLELTTCLPTNEAVARQMLQVAQQCLVANQGLPGPEAIFMKLV
VARANLALILVQRLVKSSLAVKDANQLLATLVCTINATEDPFAEQSITHYRTLLKTLFVTLRVYQKAGSKTSESP
VDVETLGVDVVQTILNVLDHVVGRGFRTLVSFIHDRDAGVSPEDLALLSAILQACLSLPTMDQSQVQILNIMASH
DTINAATSLFSWADQLVVQGDPVYGELSVLFLLELSSLPLLAEQLACDGVLSNLLSANLARYMLKANISPYAEAA
VAQRCYSIWAKGLLPLTLNLLTALGPTIAPEIAYLLNQFSHLLQASVDRFEAPSASRTRSKAAPRYLTLLATSEI
HSLALLTRILGALSLNCGREIPRVEWDAAGLLENVDFWLSTRRLLRERLLPLGSREMEWRNTKVAVGDGNHDNLL
EWKVVCQLETVREVLSEELDA
Coding >Ophio5|1048
ATGGCGCCGGTGTCTGATAGCAACTATTTCCCCTCCCTCGAGGACTGTCTATCCGGGGACCGGCTGCTTCTGTCC
TGGAAAGACGTGTCCATCGCGCTCTCAGATGAATCTGGCCATCGGCAATCGTCTTCAGCTCTCCAAAGCTTTTTG
TCTGACGAGTTCATACTCGCTTTGCTCAACGACCCGTCCAAAGCTTTCGCGCCGCCCGACGAAGCCTCCAAGGTC
GACTTCGACACCAAGACAGCGCCTATCAATGTGGCCTCGGCCTCGACCGACGGCTTTGATATCAAGACCATCAAG
AGCGACGCAGAATGGCTCAGCAAGAATGCCCGGGTCAACCTCGTTGCCGCGCTCCGCGTTGTGCTCATCGAGATG
CAGTCGCGGCCTCGCAGGCATCTCACGGGGCCGCTCTCTTCCCAAGACGCGTCAAATCTCCAAGAAGCTGCAGGC
CTCCAAAACTCACAAGGCGCATGCTTTCTATACGACTTGGGTGCCGCTTCGACTCTCGACGTGGATGAGATTACG
GCCGACTTCGATAAGCCAGACTCGAGGAAGCGGCGTCTCTTTGATACGTTCTTGACTGAGCGGCGATCGTTTATG
ATGACCATGGAATATCTATTCTCCCTTCAGCTCTACCGTCGGCTGCCGATTCTCACGTCTGCGGACCGGGGCTTG
GCCACACTTTACCGTCTCCAACCGATGGCGGATAACATGGCGTCACTCCTGCCCGCCTATCTGAAGGTGGTGTGT
GACTGCATGGGCGGCATCGAGGAGGGACTGGGGTCCTTGACGGACGATGCCCTGCTCTTGCTGCAAGAAGTCGAG
TTGGACTGGATCAGGAGCCTCCTCACTGAGACGATTCATGCTCTGTCGGTGGCATTCCAGCTCGTGGATAGCCTG
GGAAGCGAGTTTCCGCCTTCCGATGCCGTCAACCAGTGGTTCTCCTTGATGGAAGTCTACGGCTTTTTCGGATCT
GTGCAGCCGATTCATCCAGCCATTGCAGAGCTGATCCCCCCTCTCAGGGCTTTGTCTTGCGCTGTTTCGCTAAGC
CTTCTCAAACCCCTCCGATCTCTCACTTTCTTGTCCGAGAGAGAAGAGGATCCGGCGTTGCCTGACGACTCATAT
GACGCCTTTTTACTATCCTCGGACGTCCTGGAACAGATACATAAGAGCATCATCAACGTAGCTGGCGCGGATTGC
GAAGATGCCACGCCCGTCATCTTCGCCTGGACTCTGCTGCTTCACCGCATGATCGTGTCCTATCAGAACCGAACG
GAGAAGCGAGATAACTTGCAGCAGCAGAGATCCCAGGATACCTTTGAAGGAGTCATGCGGCCTACCGCCCCGAGG
CGCAACTCTGCTGGCAGCATCTTTTCAATAGAGTCCTCCAAGTTCGACGGGTTCTTGGAAAACGCCACAGGTCTC
AAGGACATGCAGCTGGTCGAGCAGCTGGCCGCCGGGGTCACAGCCCACGGAAGAGTGTTCGATGCCATCGCTGGC
ATGGCTACTTCGCTGGGACCCTCGGCTGACGGCAGCATGACGCTACTGATCAGCTCACGCATAAGGGTTGTCTTC
CTGGAGCTTCTCAAGGTCTCCTATCCCATTGTTGGATATCAATCCGAGCCGCTTGGATCGCTATTCTCCATTCTG
GCGCCGGGCCACGGTTACTGGGACCTGACCTCGTCTGAAGACCAGCTCTCGCCTGCCCAGGACGTTGTGCCCTGC
ATGCTGCATGACGACCACGCGATGGAGTTTTACTTCCAACCGGCTCTGGATCGGTTCCCGTACGAGTTTCTACCT
TTCATCACCTTTTGCAGGACATTTTGTGCGGCTACCGCGAACTTGGACGACGATAGATCCGACTTGATCCTCGAT
TTGCTCAGGAAGACGCCCTCCCTTACCTTTACCCTTCCGGACGACTTCTCCGGATACGAGCTCGTTCAGGAAGAC
GAAAACACAAACTCTTTTTGCCTGTTGCAAGAGATTCCACTGATATCCCTGTCGTCGTCTTGGAGCAGGAGATAC
ATCGAAGACGACGCCTACCGACTGCCCTCTGGGACGTATGGACGCTTCGTCACGGACTCTGGGAGAGTAGTCGTT
GTTGACTATCCCCACTCGACCCTTTCTATGCTCGGCCGGCAGCTGGAAATCAACCTTGCCAAAGAGGGCTACCAC
TCTGAACTGGGGATGCTGCAGCCGGACGACGTCGCCGAGGTCATATTCTTGCTGTCCACTCTGCTCCGAGCCGAA
CACCTGAAGGCAGACAAGATGAGTGAGGGCAACGCCTTGATACACGAAGAAAGCGACTTTTTGTTGGAAGCTGGC
CGGCACATCAGCGGCGGCAAGGACTTGGTCACCGTCATCTGCGAGACCATGGACCACTTCATGCAAGACGAGCTG
GCAATGGCCGACGATGTCGCAGTCCGCGTTCTCAGCGCTTGTGTCACGTTCTTGGATGCTATTCTGCCGGTACAG
CCGAACCGTGTCTGGTCGTATCTAGCTCGAAGCGAGCTGCTGGGCTCAGAAGCCAGGGCCGGAAAGCTGGCAAAG
ATCACCGGTACCCTTGATTTGGTGTCCGGAAGATTCGACTTGCTCATGTCTTCTCTTTACTTCTTTTCCAGGCTG
GTCGACACGGTAATGTGCTCGGGCGTCCGGCGACGGGCAGGCAACAAGCTTGCCGGCCGGCAGAAGCAGGATTCA
AACCAATGGCCCGGGACTGCCGACAGAGTGCTCACTTGGGTGAGCCTCTCCATCGCGCAGGCCTCCATCGACATT
ATGGAGAGCACGTCGACATGGCGCTTTGACTCCGAAACCGGTCGCTTGTTGGTGTTGAGCAAAGTCGTCCCCGTC
TTGGACAAGCTCGTCCTGTACAGCTACAGCATGGGCGAGTCGCCCGGCTCTGACAACCTCACATCTTGTCTCCGA
CCTGCGGCCTCGTACGTCGTCGATTGCTTCATGTCGCCGGCGACCGGCACTCTACGATACGGACCCATACTCTCA
TCTCTCGGCGCCGCCTTTGCGTCGTCGGACTGCACGCTCTATCCGAGGCGCACCGCAATAGTACAAAACCAAGCA
TGTTCCGTGCTGGGGTTTTGCACGACGCTGCTCCGCGCGGCAGACTATCTTGGTCGGTCTTCTGCGATGCTGGAA
GCCTACCTTTTCAAAAGCTCGACGCTGCTGGCCCGGCTCTCCGCCTCGCCACGTCAGGTCCGCATCCCAGTCATT
CGCTTGTTAGAGTCTCTTGTCGTCAGTGCGGGAAAGTCTGCTGGCGAGCCGCCCTCACTCCTGGGCTACCTAGGG
CCTCAAATATCAAAGTCGTTTCTGCAGTCGCTCTCTCATCTCGGAAAGCCGTTTGCTTTGACGCAGGAGGTCAAA
ACGACCTGGAGCTTCTTCTCCGCGATCTTGAGAAACCGGCAGCAATGGATGTCTAACTGCCTCTTGACCGGGCAG
ACGCCTCGCGAAGCGATGAAGGAGGGCGGCAAGAAGGGAGAGCTAGCGGCCGACTCCGTCTTTGTCCACGCCTTG
ACGAAGCTGAAGCAGCTGAAAGATGTCGAAAGTGTCGAGGCCTTGGCTGTGCTCGACTTTGTCGCCTCGGCACAG
AACTACTGGCCTTGGACCATCTTTACACTTCTAAAAGACACCTCGTACATCGACGGCCTTCGGGCGTATGTGCGC
GAACTGAGGCCGTCGCAGTGGACGTCGAAGTCCGACACCATCGGCACCAGCCTCAACGCCAGGAAAGCAGCGTAC
GTGGCGGAGACGCTGGCCATGCAGTTATACCACGCGCGCCACCAGGGCACGGCCAAAGAGCTCGCCCAAAGCCTC
GTGGCGGATCTCGACTACTACATCCGCGACGGCGTCGAGGCTGCGGGATACAACAAGTCCCTGCACAATAACTTT
GCCAAGAACTTTGCCAGCAAGTACTTCGGTTGCTCGCTGGATCTCTTCAAGCGAACGCCGTTGGAGCCCAGGGAG
CTGGGCGAAAACTACTACTATGACATGGAACGCGCCGACGATATGCTCAAGTTTGACCCGGGTTGGCTCGGGCGG
AAAGGCGACGGATTCAAGAACGAGATGGAGCTTGCAAACGCGAACTTGTCTCTGGTGGATGCTCAGATAGCCCTT
TTCCATGCGTGGGAGTTTTTACTGCTTGAACTGACCACTTGTCTGCCGACAAACGAGGCCGTTGCCAGACAGATG
TTGCAGGTCGCGCAGCAGTGTCTAGTTGCAAACCAAGGACTGCCGGGCCCGGAAGCCATCTTCATGAAGCTGGTT
GTCGCCCGGGCGAACCTGGCTCTCATCTTGGTGCAGCGACTCGTCAAGTCGTCGCTCGCGGTCAAGGACGCCAAC
CAGCTTCTGGCTACTCTCGTCTGCACCATCAACGCGACAGAGGATCCGTTCGCAGAGCAATCCATCACGCACTAT
CGCACGCTTCTGAAGACGCTGTTCGTCACGCTCCGCGTCTATCAGAAAGCCGGCTCCAAGACGTCGGAATCGCCC
GTCGACGTGGAGACGCTAGGGGTTGATGTCGTGCAGACAATACTCAATGTGCTGGACCACGTCGTTGGCAGAGGC
TTCCGGACGCTCGTCAGCTTCATCCACGACAGAGACGCCGGCGTCTCACCGGAAGACCTGGCTTTGTTGTCGGCC
ATCCTGCAGGCCTGTCTGAGTCTGCCGACGATGGACCAGTCACAGGTGCAGATTCTGAACATTATGGCGTCGCAT
GACACCATCAATGCCGCGACGTCGCTCTTCTCATGGGCCGACCAGCTGGTGGTGCAAGGCGATCCCGTGTATGGA
GAGCTGAGCGTTCTGTTCTTGCTGGAGCTCTCGAGCTTGCCGCTGCTGGCAGAGCAGCTCGCCTGCGATGGCGTC
CTCAGCAACCTGCTCTCGGCCAACCTGGCCCGATACATGCTCAAGGCCAACATCTCGCCGTATGCGGAGGCGGCC
GTCGCCCAGCGATGCTACTCCATCTGGGCCAAAGGGCTTTTGCCACTGACGCTCAACCTGCTGACGGCGCTCGGC
CCGACGATCGCGCCAGAGATTGCGTATTTGCTGAACCAGTTCTCGCACCTGCTCCAGGCCAGCGTCGATCGGTTC
GAGGCGCCGAGCGCAAGCCGGACGAGGTCCAAGGCAGCACCGCGATACTTGACCCTGCTGGCAACGTCCGAGATT
CATTCCTTGGCGTTGCTCACACGCATTCTTGGCGCCCTGAGTCTCAACTGCGGCCGCGAGATCCCCAGGGTCGAG
TGGGACGCGGCCGGCCTGTTGGAGAATGTCGATTTCTGGTTGTCTACCAGGCGACTTCTCAGAGAAAGGCTGCTG
CCGCTGGGTTCGCGGGAGATGGAGTGGAGAAACACCAAAGTGGCGGTGGGTGATGGCAACCACGACAACTTGCTG
GAGTGGAAGGTTGTTTGCCAGTTGGAGACGGTGAGGGAGGTGCTGAGCGAGGAGCTCGATGCC
Transcript >Ophio5|1048
ATGGCGCCGGTGTCTGATAGCAACTATTTCCCCTCCCTCGAGGACTGTCTATCCGGGGACCGGCTGCTTCTGTCC
TGGAAAGACGTGTCCATCGCGCTCTCAGATGAATCTGGCCATCGGCAATCGTCTTCAGCTCTCCAAAGCTTTTTG
TCTGACGAGTTCATACTCGCTTTGCTCAACGACCCGTCCAAAGCTTTCGCGCCGCCCGACGAAGCCTCCAAGGTC
GACTTCGACACCAAGACAGCGCCTATCAATGTGGCCTCGGCCTCGACCGACGGCTTTGATATCAAGACCATCAAG
AGCGACGCAGAATGGCTCAGCAAGAATGCCCGGGTCAACCTCGTTGCCGCGCTCCGCGTTGTGCTCATCGAGATG
CAGTCGCGGCCTCGCAGGCATCTCACGGGGCCGCTCTCTTCCCAAGACGCGTCAAATCTCCAAGAAGCTGCAGGC
CTCCAAAACTCACAAGGCGCATGCTTTCTATACGACTTGGGTGCCGCTTCGACTCTCGACGTGGATGAGATTACG
GCCGACTTCGATAAGCCAGACTCGAGGAAGCGGCGTCTCTTTGATACGTTCTTGACTGAGCGGCGATCGTTTATG
ATGACCATGGAATATCTATTCTCCCTTCAGCTCTACCGTCGGCTGCCGATTCTCACGTCTGCGGACCGGGGCTTG
GCCACACTTTACCGTCTCCAACCGATGGCGGATAACATGGCGTCACTCCTGCCCGCCTATCTGAAGGTGGTGTGT
GACTGCATGGGCGGCATCGAGGAGGGACTGGGGTCCTTGACGGACGATGCCCTGCTCTTGCTGCAAGAAGTCGAG
TTGGACTGGATCAGGAGCCTCCTCACTGAGACGATTCATGCTCTGTCGGTGGCATTCCAGCTCGTGGATAGCCTG
GGAAGCGAGTTTCCGCCTTCCGATGCCGTCAACCAGTGGTTCTCCTTGATGGAAGTCTACGGCTTTTTCGGATCT
GTGCAGCCGATTCATCCAGCCATTGCAGAGCTGATCCCCCCTCTCAGGGCTTTGTCTTGCGCTGTTTCGCTAAGC
CTTCTCAAACCCCTCCGATCTCTCACTTTCTTGTCCGAGAGAGAAGAGGATCCGGCGTTGCCTGACGACTCATAT
GACGCCTTTTTACTATCCTCGGACGTCCTGGAACAGATACATAAGAGCATCATCAACGTAGCTGGCGCGGATTGC
GAAGATGCCACGCCCGTCATCTTCGCCTGGACTCTGCTGCTTCACCGCATGATCGTGTCCTATCAGAACCGAACG
GAGAAGCGAGATAACTTGCAGCAGCAGAGATCCCAGGATACCTTTGAAGGAGTCATGCGGCCTACCGCCCCGAGG
CGCAACTCTGCTGGCAGCATCTTTTCAATAGAGTCCTCCAAGTTCGACGGGTTCTTGGAAAACGCCACAGGTCTC
AAGGACATGCAGCTGGTCGAGCAGCTGGCCGCCGGGGTCACAGCCCACGGAAGAGTGTTCGATGCCATCGCTGGC
ATGGCTACTTCGCTGGGACCCTCGGCTGACGGCAGCATGACGCTACTGATCAGCTCACGCATAAGGGTTGTCTTC
CTGGAGCTTCTCAAGGTCTCCTATCCCATTGTTGGATATCAATCCGAGCCGCTTGGATCGCTATTCTCCATTCTG
GCGCCGGGCCACGGTTACTGGGACCTGACCTCGTCTGAAGACCAGCTCTCGCCTGCCCAGGACGTTGTGCCCTGC
ATGCTGCATGACGACCACGCGATGGAGTTTTACTTCCAACCGGCTCTGGATCGGTTCCCGTACGAGTTTCTACCT
TTCATCACCTTTTGCAGGACATTTTGTGCGGCTACCGCGAACTTGGACGACGATAGATCCGACTTGATCCTCGAT
TTGCTCAGGAAGACGCCCTCCCTTACCTTTACCCTTCCGGACGACTTCTCCGGATACGAGCTCGTTCAGGAAGAC
GAAAACACAAACTCTTTTTGCCTGTTGCAAGAGATTCCACTGATATCCCTGTCGTCGTCTTGGAGCAGGAGATAC
ATCGAAGACGACGCCTACCGACTGCCCTCTGGGACGTATGGACGCTTCGTCACGGACTCTGGGAGAGTAGTCGTT
GTTGACTATCCCCACTCGACCCTTTCTATGCTCGGCCGGCAGCTGGAAATCAACCTTGCCAAAGAGGGCTACCAC
TCTGAACTGGGGATGCTGCAGCCGGACGACGTCGCCGAGGTCATATTCTTGCTGTCCACTCTGCTCCGAGCCGAA
CACCTGAAGGCAGACAAGATGAGTGAGGGCAACGCCTTGATACACGAAGAAAGCGACTTTTTGTTGGAAGCTGGC
CGGCACATCAGCGGCGGCAAGGACTTGGTCACCGTCATCTGCGAGACCATGGACCACTTCATGCAAGACGAGCTG
GCAATGGCCGACGATGTCGCAGTCCGCGTTCTCAGCGCTTGTGTCACGTTCTTGGATGCTATTCTGCCGGTACAG
CCGAACCGTGTCTGGTCGTATCTAGCTCGAAGCGAGCTGCTGGGCTCAGAAGCCAGGGCCGGAAAGCTGGCAAAG
ATCACCGGTACCCTTGATTTGGTGTCCGGAAGATTCGACTTGCTCATGTCTTCTCTTTACTTCTTTTCCAGGCTG
GTCGACACGGTAATGTGCTCGGGCGTCCGGCGACGGGCAGGCAACAAGCTTGCCGGCCGGCAGAAGCAGGATTCA
AACCAATGGCCCGGGACTGCCGACAGAGTGCTCACTTGGGTGAGCCTCTCCATCGCGCAGGCCTCCATCGACATT
ATGGAGAGCACGTCGACATGGCGCTTTGACTCCGAAACCGGTCGCTTGTTGGTGTTGAGCAAAGTCGTCCCCGTC
TTGGACAAGCTCGTCCTGTACAGCTACAGCATGGGCGAGTCGCCCGGCTCTGACAACCTCACATCTTGTCTCCGA
CCTGCGGCCTCGTACGTCGTCGATTGCTTCATGTCGCCGGCGACCGGCACTCTACGATACGGACCCATACTCTCA
TCTCTCGGCGCCGCCTTTGCGTCGTCGGACTGCACGCTCTATCCGAGGCGCACCGCAATAGTACAAAACCAAGCA
TGTTCCGTGCTGGGGTTTTGCACGACGCTGCTCCGCGCGGCAGACTATCTTGGTCGGTCTTCTGCGATGCTGGAA
GCCTACCTTTTCAAAAGCTCGACGCTGCTGGCCCGGCTCTCCGCCTCGCCACGTCAGGTCCGCATCCCAGTCATT
CGCTTGTTAGAGTCTCTTGTCGTCAGTGCGGGAAAGTCTGCTGGCGAGCCGCCCTCACTCCTGGGCTACCTAGGG
CCTCAAATATCAAAGTCGTTTCTGCAGTCGCTCTCTCATCTCGGAAAGCCGTTTGCTTTGACGCAGGAGGTCAAA
ACGACCTGGAGCTTCTTCTCCGCGATCTTGAGAAACCGGCAGCAATGGATGTCTAACTGCCTCTTGACCGGGCAG
ACGCCTCGCGAAGCGATGAAGGAGGGCGGCAAGAAGGGAGAGCTAGCGGCCGACTCCGTCTTTGTCCACGCCTTG
ACGAAGCTGAAGCAGCTGAAAGATGTCGAAAGTGTCGAGGCCTTGGCTGTGCTCGACTTTGTCGCCTCGGCACAG
AACTACTGGCCTTGGACCATCTTTACACTTCTAAAAGACACCTCGTACATCGACGGCCTTCGGGCGTATGTGCGC
GAACTGAGGCCGTCGCAGTGGACGTCGAAGTCCGACACCATCGGCACCAGCCTCAACGCCAGGAAAGCAGCGTAC
GTGGCGGAGACGCTGGCCATGCAGTTATACCACGCGCGCCACCAGGGCACGGCCAAAGAGCTCGCCCAAAGCCTC
GTGGCGGATCTCGACTACTACATCCGCGACGGCGTCGAGGCTGCGGGATACAACAAGTCCCTGCACAATAACTTT
GCCAAGAACTTTGCCAGCAAGTACTTCGGTTGCTCGCTGGATCTCTTCAAGCGAACGCCGTTGGAGCCCAGGGAG
CTGGGCGAAAACTACTACTATGACATGGAACGCGCCGACGATATGCTCAAGTTTGACCCGGGTTGGCTCGGGCGG
AAAGGCGACGGATTCAAGAACGAGATGGAGCTTGCAAACGCGAACTTGTCTCTGGTGGATGCTCAGATAGCCCTT
TTCCATGCGTGGGAGTTTTTACTGCTTGAACTGACCACTTGTCTGCCGACAAACGAGGCCGTTGCCAGACAGATG
TTGCAGGTCGCGCAGCAGTGTCTAGTTGCAAACCAAGGACTGCCGGGCCCGGAAGCCATCTTCATGAAGCTGGTT
GTCGCCCGGGCGAACCTGGCTCTCATCTTGGTGCAGCGACTCGTCAAGTCGTCGCTCGCGGTCAAGGACGCCAAC
CAGCTTCTGGCTACTCTCGTCTGCACCATCAACGCGACAGAGGATCCGTTCGCAGAGCAATCCATCACGCACTAT
CGCACGCTTCTGAAGACGCTGTTCGTCACGCTCCGCGTCTATCAGAAAGCCGGCTCCAAGACGTCGGAATCGCCC
GTCGACGTGGAGACGCTAGGGGTTGATGTCGTGCAGACAATACTCAATGTGCTGGACCACGTCGTTGGCAGAGGC
TTCCGGACGCTCGTCAGCTTCATCCACGACAGAGACGCCGGCGTCTCACCGGAAGACCTGGCTTTGTTGTCGGCC
ATCCTGCAGGCCTGTCTGAGTCTGCCGACGATGGACCAGTCACAGGTGCAGATTCTGAACATTATGGCGTCGCAT
GACACCATCAATGCCGCGACGTCGCTCTTCTCATGGGCCGACCAGCTGGTGGTGCAAGGCGATCCCGTGTATGGA
GAGCTGAGCGTTCTGTTCTTGCTGGAGCTCTCGAGCTTGCCGCTGCTGGCAGAGCAGCTCGCCTGCGATGGCGTC
CTCAGCAACCTGCTCTCGGCCAACCTGGCCCGATACATGCTCAAGGCCAACATCTCGCCGTATGCGGAGGCGGCC
GTCGCCCAGCGATGCTACTCCATCTGGGCCAAAGGGCTTTTGCCACTGACGCTCAACCTGCTGACGGCGCTCGGC
CCGACGATCGCGCCAGAGATTGCGTATTTGCTGAACCAGTTCTCGCACCTGCTCCAGGCCAGCGTCGATCGGTTC
GAGGCGCCGAGCGCAAGCCGGACGAGGTCCAAGGCAGCACCGCGATACTTGACCCTGCTGGCAACGTCCGAGATT
CATTCCTTGGCGTTGCTCACACGCATTCTTGGCGCCCTGAGTCTCAACTGCGGCCGCGAGATCCCCAGGGTCGAG
TGGGACGCGGCCGGCCTGTTGGAGAATGTCGATTTCTGGTTGTCTACCAGGCGACTTCTCAGAGAAAGGCTGCTG
CCGCTGGGTTCGCGGGAGATGGAGTGGAGAAACACCAAAGTGGCGGTGGGTGATGGCAACCACGACAACTTGCTG
GAGTGGAAGGTTGTTTGCCAGTTGGAGACGGTGAGGGAGGTGCTGAGCGAGGAGCTCGATGCCTGA
Gene >Ophio5|1048
ATGGCGCCGGTGTCTGATAGCAACTATTTCCCCTCCCTCGAGGACTGTCTATCCGGGGACCGGCTGCTTCTGTGC
GCAACGCCCGACTCTCGGCTTGCTTCATCGGCTAACTCCATGCCAGGTCCTGGAAAGACGTGTCCATCGCGCTCT
CAGATGAATCTGGCCATCGGCAATCGTCTTCAGCTCTCCAAAGCTTTTTGTCTGACGAGTTCATACTCGCTTTGC
TCAACGACCCGTCCAAAGCTTTCGCGCCGCCCGACGAAGCCTCCAAGGTCGACTTCGACACCAAGACAGCGCCTA
TCAATGTGGCCTCGGCCTCGACCGACGGCTTTGATATCAAGACCATCAAGAGCGACGCAGAATGGCTCAGCAAGA
ATGCCCGGGTCAACCTCGTTGCCGCGCTCCGCGTTGTGCTCATCGAGATGCAGTCGCGGCCTCGCAGGCATCTCA
CGGGGCCGCTCTCTTCCCAAGACGCGTCAAATCTCCAAGAAGCTGCAGGCCTCCAAAACTCACAAGGCGCATGCT
TTCTATACGACTTGGGTGCCGCTTCGACTCTCGACGTGGATGAGATTACGGCCGACTTCGATAAGCCAGACTCGA
GGAAGCGGCGTCTCTTTGATACGTTCTTGACTGAGCGGCGATCGTTTATGATGACCATGGAATATCTATTCTCCC
TTCAGCTCTACCGTCGGCTGCCGATTCTCACGTCTGCGGACCGGGGCTTGGCCACACTTTACCGTCTCCAACCGA
TGGCGGATAACATGGCGTCACTCCTGCCCGCCTATCTGAAGGTGGTGTGTGACTGCATGGGCGGCATCGAGGAGG
GACTGGGGTCCTTGACGGACGATGCCCTGCTCTTGCTGCAAGAAGTCGAGTTGGACTGGATCAGGAGCCTCCTCA
CTGAGACGATTCATGCTCTGTCGGTGGCATTCCAGCTCGTGGATAGCCTGGGAAGCGAGTTTCCGCCTTCCGATG
CCGTCAACCAGTGGTTCTCCTTGATGGAAGTCTACGGCTTTTTCGGATCTGTGCAGCCGGTGAGTGTCGGTTTCT
CCCAGGTCAAATTCACGGATGCGCTGACACTCGGTCAGATTCATCCAGCCATTGCAGAGCTGATCCCCCCTCTCA
GGGCTTTGTCTTGCGCTGTTTCGCTAAGCCTTCTCAAACCCCTCCGATCTCTCACTTTCTTGTCCGAGAGAGAAG
AGGATCCGGCGTTGCCTGACGACTCATATGACGCCTTTTTACTATCCTCGGACGTCCTGGAACAGATACATAAGA
GCATCATCAACGTAGCTGGCGCGGATTGCGAAGATGCCACGCCCGTCATCTTCGCCTGGACTCTGCTGCTTCACC
GCATGATCGTGTCCTATCAGAACCGAACGGAGAAGCGAGATAACTTGCAGCAGCAGAGATCCCAGGATACCTTTG
AAGGAGTCATGCGGCCTACCGCCCCGAGGCGCAACTCTGCTGGCAGCATCTTTTCAATAGAGTCCTCCAAGTTCG
ACGGGTTCTTGGAAAACGCCACAGGTCTCAAGGACATGCAGCTGGTCGAGCAGCTGGCCGCCGGGGTCACAGCCC
ACGGAAGAGTGTTCGATGCCATCGCTGGCATGGCTACTTCGCTGGGACCCTCGGCTGACGGCAGCATGACGCTAC
TGATCAGCTCACGCATAAGGGTTGTCTTCCTGGAGCTTCTCAAGGTCTCCTATCCCATTGTTGGATATCAATCCG
AGCCGCTTGGATCGCTATTCTCCATTCTGGCGCCGGGCCACGGTTACTGGGACCTGACCTCGTCTGAAGACCAGC
TCTCGCCTGCCCAGGACGTTGTGCCCTGCATGCTGCATGACGACCACGCGATGGAGTTTTACTTCCAACCGGCTC
TGGATCGGTTCCCGTACGAGTTTCTACCTTTCATCACCTTTTGCAGGACATTTTGTGCGGCTACCGCGAACTTGG
ACGACGATAGATCCGACTTGATCCTCGATTTGCTCAGGAAGACGCCCTCCCTTACCTTTACCCTTCCGGACGACT
TCTCCGGATACGAGCTCGTTCAGGAAGACGAAAACACAAACTCTTTTTGCCTGTTGCAAGAGATTCCACTGATAT
CCCTGTCGTCGTCTTGGAGCAGGAGATACATCGAAGACGACGCCTACCGACTGCCCTCTGGGACGTATGGACGCT
TCGTCACGGACTCTGGGAGAGTAGTCGTTGTTGACTATCCCCACTCGACCCTTTCTATGCTCGGCCGGCAGCTGG
AAATCAACCTTGCCAAAGAGGGCTACCACTCTGAACTGGGGATGCTGCAGCCGGACGACGTCGCCGAGGTCATAT
TCTTGCTGTCCACTCTGCTCCGAGCCGAACACCTGAAGGCAGACAAGATGAGTGAGGGCAACGCCTTGATACACG
AAGAAAGCGACTTTTTGTTGGAAGCTGGCCGGCACATCAGCGGCGGCAAGGACTTGGTCACCGTCATCTGCGAGA
CCATGGACCACTTCATGCAAGACGAGCTGGCAATGGCCGACGATGTCGCAGTCCGCGTTCTCAGCGCTTGTGTCA
CGTTCTTGGATGCTATTCTGCCGGTACAGCCGAACCGTGTCTGGTCGTATCTAGCTCGAAGCGAGCTGCTGGGCT
CAGAAGCCAGGGCCGGAAAGCTGGCAAAGATCACCGGTACCCTTGATTTGGTGTCCGGAAGATTCGACTTGCTCA
TGTCTTCTCTTTACTTCTTTTCCAGGCTGGTCGACACGGTAATGTGCTCGGGCGTCCGGCGACGGGCAGGCAACA
AGCTTGCCGGCCGGCAGAAGCAGGATTCAAACCAATGGCCCGGGACTGCCGACAGAGTGCTCACTTGGGTGAGCC
TCTCCATCGCGCAGGCCTCCATCGACATTATGGAGAGCACGTCGACATGGCGCTTTGACTCCGAAACCGGTCGCT
TGTTGGTGTTGAGCAAAGTCGTCCCCGTCTTGGACAAGCTCGTCCTGTACAGCTACAGCATGGGCGAGTCGCCCG
GCTCTGACAACCTCACATCTTGTCTCCGACCTGCGGCCTCGTACGTCGTCGATTGCTTCATGTCGCCGGCGACCG
GCACTCTACGATACGGACCCATACTCTCATCTCTCGGCGCCGCCTTTGCGTCGTCGGACTGCACGCTCTATCCGA
GGCGCACCGCAATAGTACAAAACCAAGCATGTTCCGTGCTGGGGTTTTGCACGACGCTGCTCCGCGCGGCAGACT
ATCTTGGTCGGTCTTCTGCGATGCTGGAAGCCTACCTTTTCAAAAGCTCGACGCTGCTGGCCCGGCTCTCCGCCT
CGCCACGTCAGGTCCGCATCCCAGTCATTCGCTTGTTAGAGTCTCTTGTCGTCAGTGCGGGAAAGTCTGCTGGCG
AGCCGCCCTCACTCCTGGGCTACCTAGGGCCTCAAATATCAAAGTCGTTTCTGCAGTCGCTCTCTCATCTCGGAA
AGCCGTTTGCTTTGACGCAGGAGGTCAAAACGACCTGGAGCTTCTTCTCCGCGATCTTGAGAAACCGGCAGCAAT
GGATGTCTAACTGCCTCTTGACCGGGCAGACGCCTCGCGAAGCGATGAAGGAGGGCGGCAAGAAGGGAGAGCTAG
CGGCCGACTCCGTCTTTGTCCACGCCTTGACGAAGCTGAAGCAGCTGAAAGATGTCGAAAGTGTCGAGGCCTTGG
CTGTGCTCGACTTTGTCGCCTCGGCACAGAACTACTGGCCTTGGACCATCTTTACACTTCTAAAAGACACCTCGT
ACATCGACGGCCTTCGGGCGTATGTGCGCGAACTGAGGCCGTCGCAGTGGACGTCGAAGTCCGACACCATCGGCA
CCAGCCTCAACGCCAGGAAAGCAGCGTACGTGGCGGAGACGCTGGCCATGCAGTTATACCACGCGCGCCACCAGG
GCACGGCCAAAGAGCTCGCCCAAAGCCTCGTGGCGGATCTCGACTACTACATCCGCGACGGCGTCGAGGCTGCGG
GATACAACAAGTCCCTGCACAATAACTTTGCCAAGAACTTTGCCAGCAAGTACTTCGGTTGCTCGCTGGATCTCT
TCAAGCGAACGCCGTTGGAGCCCAGGGAGCTGGGCGAAAACTACTACTATGACATGGAACGCGCCGACGATATGC
TCAAGTTTGACCCGGGTTGGCTCGGGCGGAAAGGCGACGGATTCAAGAACGAGATGGAGCTTGCAAACGCGAACT
TGTCTCTGGTGGATGCTCAGATAGTAAGCCGCAGGACCGTCTTGGCGAGTTGACGACGCTGACCATGGTTATGCA
GGCCCTTTTCCATGCGTGGGAGTTTTTACTGCTTGAACTGACCACTTGTCTGCCGACAAACGAGGCCGTTGCCAG
ACAGATGTTGCAGGTCGCGCAGCAGTGTCTAGTTGCAAACCAAGGACTGCCGGGCCCGGAAGCCATCTTCATGAA
GCTGGTTGTCGCCCGGGCGAACCTGGCTCTCATCTTGGTGCAGCGACTCGTCAAGTCGTCGCTCGCGGTCAAGGA
CGCCAACCAGCTTCTGGCTACTCTCGTCTGCACCATCAACGCGACAGAGGATCCGTTCGCAGAGCAATCCATCAC
GCACTATCGCACGCTTCTGAAGACGCTGTTCGTCACGCTCCGCGTCTATCAGAAAGCCGGCTCCAAGACGTCGGA
ATCGCCCGTCGACGTGGAGACGCTAGGGGTTGATGTCGTGCAGACAATACTCAATGTGCTGGACCACGTCGTTGG
CAGAGGCTTCCGGACGCTCGTCAGCTTCATCCACGACAGAGACGCCGGCGTCTCACCGGAAGACCTGGCTTTGTT
GTCGGCCATCCTGCAGGCCTGTCTGAGTCTGCCGACGATGGACCAGTCACAGGTGCAGATTCTGAACATTATGGC
GTCGCATGACACCATCAATGCCGCGACGTCGCTCTTCTCATGGGCCGACCAGCTGGTGGTGCAAGGCGATCCCGT
GTATGGAGAGCTGAGCGTTCTGTTCTTGCTGGAGCTCTCGAGCTTGCCGCTGCTGGCAGAGCAGCTCGCCTGCGA
TGGCGTCCTCAGCAACCTGCTCTCGGCCAACCTGGCCCGATACATGCTCAAGGCCAACATCTCGCCGTATGCGGA
GGCGGCCGTCGCCCAGCGATGCTACTCCATCTGGGCCAAAGGGCTTTTGCCACTGACGCTCAACCTGCTGACGGC
GCTCGGCCCGACGATCGCGCCAGAGATTGCGTATTTGCTGAACCAGTTCTCGCACCTGCTCCAGGCCAGCGTCGA
TCGGTTCGAGGCGCCGAGCGCAAGCCGGACGAGGTCCAAGGCAGCACCGCGATACTTGACCCTGCTGGCAACGTC
CGAGATTCATTCCTTGGCGTTGCTCACACGCATTCTTGGCGCCCTGAGTCTCAACTGCGGCCGCGAGATCCCCAG
GGTCGAGTGGGACGCGGCCGGCCTGTTGGAGAATGTCGATTTCTGGTTGTCTACCAGGCGACTTCTCAGAGAAAG
GCTGCTGCCGCTGGGTTCGCGGGAGATGGAGTGGAGAAACACCAAAGTGGCGGTGGGTGATGGCAACCACGACAA
CTTGCTGGAGTGGAAGGTTGTTTGCCAGTTGGAGACGGTGAGGGAGGTGCTGAGCGAGGAGCTCGATGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail