Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|104
Gene name
Locationscaffold_100:858..2842
Strand+
Gene length (bp)1984
Transcript length (bp)1911
Coding sequence length (bp)1908
Protein length (aa) 636

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 455 477 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 10.19 4.38 16.00
CcL In ants, during behavior modification 11.44 4.69 18.19
CcD In ants, recently dead 13.00 5.91 20.09

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.733054 no
SC16a CcD 0.419095 no
CcL CcD 0.699263 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|104
MILFAFRLLLLTVLVGRNTATPLGLHNASSLEPEHGIQTPTTSDIEHFLTQMTRFKGSDDNDGDDGDDGDDGDDG
DDGDDGDDGDDGDHKGYLILKPDVGGQPASPSATPGASHPTTDSHLKRPAHENMPQHQYDASLITPEYTYEDLLA
VEEPEYEQISEDHVDDTAIRRLHKRVMRAWARATEAEESIKAADNLEAVETTLRRAEDAAEEAFKITRELGLLKA
DGLDTTEQQASFQSALLATMSARVTAASGRSQAAGLMAGILLPEQSKKQELMEKMATMNVSEAVHYRQRMREAAR
QLNTQLINFHHYEELLVSRNGMLVMSWLRGESSDKPTTQQATYLRLWSETAAEAISREKRVLDIITKCARDAEAK
LMESAATAMDLADKFSAAIDEAKARAARQAKEQAEKEAALLAQEITTRATASRQAKEEEAKRKVELAVEQLLEMN
ERETPWWTSFIMGVSIVSAIIPAVVVVNALASQSGMTGAQTAGALGFTSLPLHVAIPVLKGALGIAETTLLGAIE
PISVTASVAETSTAQTTSGKMASIVGELPIVSDALLPPLRVATSIFTRSLPSLDAADLLRRDDELREMVIDAVAD
AIQDAVSAAERDMLGSEEHGLMDEDEGVGDGEGGAY
Coding >Ophio5|104
ATGATTCTCTTCGCCTTCCGCCTCCTCCTCCTGACTGTACTGGTCGGAAGAAATACGGCGACGCCCCTTGGCCTA
CACAACGCATCATCCCTTGAGCCAGAACATGGCATCCAGACGCCAACGACCTCGGATATCGAACACTTTCTTACT
CAAATGACGAGATTCAAGGGCTCAGATGATAATGATGGTGATGATGGTGATGATGGTGATGATGGTGATGATGGT
GATGATGGTGATGATGGTGATGATGGTGATGATGGTGATCATAAAGGCTACTTGATTCTCAAGCCCGACGTCGGC
GGCCAACCTGCCTCTCCCTCGGCAACGCCGGGTGCCTCTCATCCGACAACAGATTCACACCTGAAGCGCCCCGCT
CACGAGAACATGCCTCAGCATCAATACGACGCCTCACTCATCACGCCCGAGTACACCTACGAGGATTTGCTAGCG
GTTGAAGAGCCCGAGTACGAACAGATCTCAGAAGACCATGTTGATGACACTGCTATACGACGCTTGCATAAGCGA
GTAATGCGTGCCTGGGCTAGGGCTACTGAGGCCGAGGAGAGCATCAAGGCAGCAGACAACTTGGAGGCGGTGGAA
ACGACGTTGAGAAGAGCAGAGGATGCCGCAGAGGAAGCATTCAAGATTACGAGGGAACTAGGACTCTTGAAGGCT
GACGGTCTTGACACGACCGAACAGCAGGCGAGCTTCCAGTCGGCCTTGCTTGCGACGATGAGCGCCAGAGTGACG
GCAGCCAGCGGCCGCAGTCAGGCGGCGGGCTTGATGGCCGGCATTTTGCTCCCCGAACAGAGCAAGAAGCAGGAG
CTGATGGAGAAGATGGCGACGATGAATGTAAGCGAGGCGGTCCACTATCGCCAGAGAATGCGAGAGGCAGCCAGG
CAACTGAACACACAACTCATCAACTTCCACCACTACGAAGAGCTCCTCGTCAGTCGCAACGGGATGCTGGTCATG
TCTTGGCTGAGAGGCGAGTCGAGTGACAAGCCGACGACGCAACAAGCGACATACCTCCGGTTATGGTCCGAAACC
GCGGCCGAGGCCATCTCGAGAGAAAAGAGGGTGCTGGACATAATCACCAAATGTGCCAGAGACGCGGAAGCGAAA
CTAATGGAATCGGCGGCCACGGCCATGGACTTGGCGGACAAGTTCTCGGCCGCCATCGACGAGGCCAAAGCCAGG
GCAGCCCGACAAGCCAAGGAACAGGCAGAGAAGGAAGCGGCATTGCTGGCACAGGAGATCACGACGAGAGCAACG
GCCTCGCGGCAAGCCAAGGAGGAAGAGGCGAAAAGAAAAGTCGAGTTGGCGGTGGAACAGCTGCTAGAGATGAAC
GAGAGGGAGACGCCATGGTGGACCAGCTTCATCATGGGAGTCAGCATCGTGAGCGCCATCATACCTGCCGTCGTC
GTCGTTAATGCGCTCGCGTCACAAAGTGGCATGACCGGGGCTCAAACGGCGGGGGCCTTGGGCTTCACATCCTTG
CCCCTACATGTTGCCATCCCGGTGCTTAAAGGGGCTTTAGGCATCGCCGAGACGACCCTTCTAGGGGCCATAGAG
CCTATTTCCGTGACGGCGTCGGTGGCGGAAACGTCGACGGCGCAGACGACGTCGGGGAAGATGGCCAGCATCGTC
GGCGAGCTACCCATCGTGTCCGACGCTCTCTTGCCGCCCCTTCGCGTCGCCACGTCCATCTTCACCCGCTCTTTG
CCGTCTCTCGATGCCGCCGATCTGTTGAGGAGGGATGATGAGCTTCGGGAAATGGTGATTGATGCCGTTGCCGAC
GCTATCCAAGACGCTGTATCGGCTGCCGAGAGGGATATGCTCGGCTCGGAAGAGCACGGATTGATGGACGAGGAC
GAGGGAGTTGGTGATGGAGAGGGAGGAGCCTAT
Transcript >Ophio5|104
ATGATTCTCTTCGCCTTCCGCCTCCTCCTCCTGACTGTACTGGTCGGAAGAAATACGGCGACGCCCCTTGGCCTA
CACAACGCATCATCCCTTGAGCCAGAACATGGCATCCAGACGCCAACGACCTCGGATATCGAACACTTTCTTACT
CAAATGACGAGATTCAAGGGCTCAGATGATAATGATGGTGATGATGGTGATGATGGTGATGATGGTGATGATGGT
GATGATGGTGATGATGGTGATGATGGTGATGATGGTGATCATAAAGGCTACTTGATTCTCAAGCCCGACGTCGGC
GGCCAACCTGCCTCTCCCTCGGCAACGCCGGGTGCCTCTCATCCGACAACAGATTCACACCTGAAGCGCCCCGCT
CACGAGAACATGCCTCAGCATCAATACGACGCCTCACTCATCACGCCCGAGTACACCTACGAGGATTTGCTAGCG
GTTGAAGAGCCCGAGTACGAACAGATCTCAGAAGACCATGTTGATGACACTGCTATACGACGCTTGCATAAGCGA
GTAATGCGTGCCTGGGCTAGGGCTACTGAGGCCGAGGAGAGCATCAAGGCAGCAGACAACTTGGAGGCGGTGGAA
ACGACGTTGAGAAGAGCAGAGGATGCCGCAGAGGAAGCATTCAAGATTACGAGGGAACTAGGACTCTTGAAGGCT
GACGGTCTTGACACGACCGAACAGCAGGCGAGCTTCCAGTCGGCCTTGCTTGCGACGATGAGCGCCAGAGTGACG
GCAGCCAGCGGCCGCAGTCAGGCGGCGGGCTTGATGGCCGGCATTTTGCTCCCCGAACAGAGCAAGAAGCAGGAG
CTGATGGAGAAGATGGCGACGATGAATGTAAGCGAGGCGGTCCACTATCGCCAGAGAATGCGAGAGGCAGCCAGG
CAACTGAACACACAACTCATCAACTTCCACCACTACGAAGAGCTCCTCGTCAGTCGCAACGGGATGCTGGTCATG
TCTTGGCTGAGAGGCGAGTCGAGTGACAAGCCGACGACGCAACAAGCGACATACCTCCGGTTATGGTCCGAAACC
GCGGCCGAGGCCATCTCGAGAGAAAAGAGGGTGCTGGACATAATCACCAAATGTGCCAGAGACGCGGAAGCGAAA
CTAATGGAATCGGCGGCCACGGCCATGGACTTGGCGGACAAGTTCTCGGCCGCCATCGACGAGGCCAAAGCCAGG
GCAGCCCGACAAGCCAAGGAACAGGCAGAGAAGGAAGCGGCATTGCTGGCACAGGAGATCACGACGAGAGCAACG
GCCTCGCGGCAAGCCAAGGAGGAAGAGGCGAAAAGAAAAGTCGAGTTGGCGGTGGAACAGCTGCTAGAGATGAAC
GAGAGGGAGACGCCATGGTGGACCAGCTTCATCATGGGAGTCAGCATCGTGAGCGCCATCATACCTGCCGTCGTC
GTCGTTAATGCGCTCGCGTCACAAAGTGGCATGACCGGGGCTCAAACGGCGGGGGCCTTGGGCTTCACATCCTTG
CCCCTACATGTTGCCATCCCGGTGCTTAAAGGGGCTTTAGGCATCGCCGAGACGACCCTTCTAGGGGCCATAGAG
CCTATTTCCGTGACGGCGTCGGTGGCGGAAACGTCGACGGCGCAGACGACGTCGGGGAAGATGGCCAGCATCGTC
GGCGAGCTACCCATCGTGTCCGACGCTCTCTTGCCGCCCCTTCGCGTCGCCACGTCCATCTTCACCCGCTCTTTG
CCGTCTCTCGATGCCGCCGATCTGTTGAGGAGGGATGATGAGCTTCGGGAAATGGTGATTGATGCCGTTGCCGAC
GCTATCCAAGACGCTGTATCGGCTGCCGAGAGGGATATGCTCGGCTCGGAAGAGCACGGATTGATGGACGAGGAC
GAGGGAGTTGGTGATGGAGAGGGAGGAGCCTATTGA
Gene >Ophio5|104
ATGATTCTCTTCGCCTTCCGCCTCCTCCTCCTGACTGTACTGGTCGGAAGAAATACGGCGACGCCCCTTGGCCTA
CACAACGCATCATCCCTTGAGCCAGAACATGGCATCCAGACGCCAACGACCTCGGATATCGAACACTTTCTTACT
CAAATGGTAATGGCGGGACCTCGTCAACGACCCAAAAATATAGAAAAAAAAAATTGCATGACAAAAACAAACTAA
CTAGACGAGATTCAAGGGCTCAGATGATAATGATGGTGATGATGGTGATGATGGTGATGATGGTGATGATGGTGA
TGATGGTGATGATGGTGATGATGGTGATGATGGTGATCATAAAGGCTACTTGATTCTCAAGCCCGACGTCGGCGG
CCAACCTGCCTCTCCCTCGGCAACGCCGGGTGCCTCTCATCCGACAACAGATTCACACCTGAAGCGCCCCGCTCA
CGAGAACATGCCTCAGCATCAATACGACGCCTCACTCATCACGCCCGAGTACACCTACGAGGATTTGCTAGCGGT
TGAAGAGCCCGAGTACGAACAGATCTCAGAAGACCATGTTGATGACACTGCTATACGACGCTTGCATAAGCGAGT
AATGCGTGCCTGGGCTAGGGCTACTGAGGCCGAGGAGAGCATCAAGGCAGCAGACAACTTGGAGGCGGTGGAAAC
GACGTTGAGAAGAGCAGAGGATGCCGCAGAGGAAGCATTCAAGATTACGAGGGAACTAGGACTCTTGAAGGCTGA
CGGTCTTGACACGACCGAACAGCAGGCGAGCTTCCAGTCGGCCTTGCTTGCGACGATGAGCGCCAGAGTGACGGC
AGCCAGCGGCCGCAGTCAGGCGGCGGGCTTGATGGCCGGCATTTTGCTCCCCGAACAGAGCAAGAAGCAGGAGCT
GATGGAGAAGATGGCGACGATGAATGTAAGCGAGGCGGTCCACTATCGCCAGAGAATGCGAGAGGCAGCCAGGCA
ACTGAACACACAACTCATCAACTTCCACCACTACGAAGAGCTCCTCGTCAGTCGCAACGGGATGCTGGTCATGTC
TTGGCTGAGAGGCGAGTCGAGTGACAAGCCGACGACGCAACAAGCGACATACCTCCGGTTATGGTCCGAAACCGC
GGCCGAGGCCATCTCGAGAGAAAAGAGGGTGCTGGACATAATCACCAAATGTGCCAGAGACGCGGAAGCGAAACT
AATGGAATCGGCGGCCACGGCCATGGACTTGGCGGACAAGTTCTCGGCCGCCATCGACGAGGCCAAAGCCAGGGC
AGCCCGACAAGCCAAGGAACAGGCAGAGAAGGAAGCGGCATTGCTGGCACAGGAGATCACGACGAGAGCAACGGC
CTCGCGGCAAGCCAAGGAGGAAGAGGCGAAAAGAAAAGTCGAGTTGGCGGTGGAACAGCTGCTAGAGATGAACGA
GAGGGAGACGCCATGGTGGACCAGCTTCATCATGGGAGTCAGCATCGTGAGCGCCATCATACCTGCCGTCGTCGT
CGTTAATGCGCTCGCGTCACAAAGTGGCATGACCGGGGCTCAAACGGCGGGGGCCTTGGGCTTCACATCCTTGCC
CCTACATGTTGCCATCCCGGTGCTTAAAGGGGCTTTAGGCATCGCCGAGACGACCCTTCTAGGGGCCATAGAGCC
TATTTCCGTGACGGCGTCGGTGGCGGAAACGTCGACGGCGCAGACGACGTCGGGGAAGATGGCCAGCATCGTCGG
CGAGCTACCCATCGTGTCCGACGCTCTCTTGCCGCCCCTTCGCGTCGCCACGTCCATCTTCACCCGCTCTTTGCC
GTCTCTCGATGCCGCCGATCTGTTGAGGAGGGATGATGAGCTTCGGGAAATGGTGATTGATGCCGTTGCCGACGC
TATCCAAGACGCTGTATCGGCTGCCGAGAGGGATATGCTCGGCTCGGAAGAGCACGGATTGATGGACGAGGACGA
GGGAGTTGGTGATGGAGAGGGAGGAGCCTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail