Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1034
Gene name
Locationscaffold_131:23371..24080
Strand+
Gene length (bp)709
Transcript length (bp)621
Coding sequence length (bp)618
Protein length (aa) 206

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05700 BCAS2 Breast carcinoma amplified sequence 2 (BCAS2) 8.8E-44 8 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RAX7|SPF27_PONAB Pre-mRNA-splicing factor SPF27 OS=Pongo abelii GN=BCAS2 PE=2 SV=1 42 190 1.0E-10
sp|Q9D287|SPF27_MOUSE Pre-mRNA-splicing factor SPF27 OS=Mus musculus GN=Bcas2 PE=1 SV=1 42 190 2.0E-09
sp|O75934|SPF27_HUMAN Pre-mRNA-splicing factor SPF27 OS=Homo sapiens GN=BCAS2 PE=1 SV=1 42 190 2.0E-09
sp|Q949S9|SPF27_ARATH Pre-mRNA-splicing factor SPF27 homolog OS=Arabidopsis thaliana GN=MOS4 PE=1 SV=1 9 190 2.0E-09
sp|Q5RKQ0|SPF27_DANRE Pre-mRNA-splicing factor SPF27 OS=Danio rerio GN=bcas2 PE=2 SV=1 45 194 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RAX7|SPF27_PONAB Pre-mRNA-splicing factor SPF27 OS=Pongo abelii GN=BCAS2 PE=2 SV=1 42 190 1.0E-10
sp|Q9D287|SPF27_MOUSE Pre-mRNA-splicing factor SPF27 OS=Mus musculus GN=Bcas2 PE=1 SV=1 42 190 2.0E-09
sp|O75934|SPF27_HUMAN Pre-mRNA-splicing factor SPF27 OS=Homo sapiens GN=BCAS2 PE=1 SV=1 42 190 2.0E-09
sp|Q949S9|SPF27_ARATH Pre-mRNA-splicing factor SPF27 homolog OS=Arabidopsis thaliana GN=MOS4 PE=1 SV=1 9 190 2.0E-09
sp|Q5RKQ0|SPF27_DANRE Pre-mRNA-splicing factor SPF27 OS=Danio rerio GN=bcas2 PE=2 SV=1 45 194 5.0E-08
sp|Q6PBE2|SPF27_XENTR Pre-mRNA-splicing factor SPF27 OS=Xenopus tropicalis GN=bcas2 PE=2 SV=1 45 190 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006397 mRNA processing Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008152 metabolic process No
GO:0016071 mRNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0016070 RNA metabolic process No
GO:0006396 RNA processing No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1034
MEAPPAMQDSLPYIETEPSPSARASAQALLAAEEKTQPAPALFPPAYRVKLTKALTAEVERIASKQSSVPLPLSR
YEAQEPPASDAVRPALEAAYVSAAYLAARARNLDLLDSYGPNAWLLHNYHLDSLRQRLDSQRAAVAADIDVVNAR
RQALQMDAKPELDALEAEWKRTLAQVLETELDVCRLEAQIRRQRRALVAQHSDTPT
Coding >Ophio5|1034
ATGGAGGCGCCTCCCGCCATGCAGGATTCCCTCCCCTACATCGAGACGGAACCGTCCCCTTCGGCTCGGGCGTCG
GCCCAGGCGCTCTTGGCAGCAGAGGAAAAAACCCAACCGGCTCCGGCTTTATTCCCACCAGCCTACAGGGTCAAG
TTGACCAAGGCGCTGACGGCCGAGGTAGAGCGGATCGCCTCCAAGCAGTCTTCGGTTCCGCTCCCGCTGTCACGG
TACGAAGCGCAGGAGCCGCCGGCGTCGGATGCGGTCCGTCCCGCGCTGGAGGCTGCTTACGTCTCGGCTGCCTAT
CTTGCTGCGCGGGCGAGGAATCTCGATTTGTTGGATTCGTATGGGCCCAATGCTTGGCTGTTGCATAATTATCAT
CTGGATTCGTTGCGGCAGAGACTCGATTCCCAGAGAGCTGCCGTCGCGGCTGATATCGATGTCGTCAATGCCCGC
AGGCAGGCTCTTCAGATGGACGCCAAGCCAGAGTTGGACGCCTTGGAGGCCGAGTGGAAGAGGACGCTGGCTCAG
GTGCTCGAGACGGAACTCGACGTTTGTCGCTTAGAGGCTCAGATTCGTCGTCAGCGTCGCGCCCTCGTCGCTCAA
CACTCGGACACGCCCACC
Transcript >Ophio5|1034
ATGGAGGCGCCTCCCGCCATGCAGGATTCCCTCCCCTACATCGAGACGGAACCGTCCCCTTCGGCTCGGGCGTCG
GCCCAGGCGCTCTTGGCAGCAGAGGAAAAAACCCAACCGGCTCCGGCTTTATTCCCACCAGCCTACAGGGTCAAG
TTGACCAAGGCGCTGACGGCCGAGGTAGAGCGGATCGCCTCCAAGCAGTCTTCGGTTCCGCTCCCGCTGTCACGG
TACGAAGCGCAGGAGCCGCCGGCGTCGGATGCGGTCCGTCCCGCGCTGGAGGCTGCTTACGTCTCGGCTGCCTAT
CTTGCTGCGCGGGCGAGGAATCTCGATTTGTTGGATTCGTATGGGCCCAATGCTTGGCTGTTGCATAATTATCAT
CTGGATTCGTTGCGGCAGAGACTCGATTCCCAGAGAGCTGCCGTCGCGGCTGATATCGATGTCGTCAATGCCCGC
AGGCAGGCTCTTCAGATGGACGCCAAGCCAGAGTTGGACGCCTTGGAGGCCGAGTGGAAGAGGACGCTGGCTCAG
GTGCTCGAGACGGAACTCGACGTTTGTCGCTTAGAGGCTCAGATTCGTCGTCAGCGTCGCGCCCTCGTCGCTCAA
CACTCGGACACGCCCACCTGA
Gene >Ophio5|1034
ATGGAGGCGCCTCCCGCCATGCAGGATTCCCTCCCCTGTGCGTCTTCTATTTTCCGCGGGCGGCCCCGTCTCGCC
GTCGGTCGTCATGAGCTCGAGGCGGAAAGCTGACGGGAAATGGTAGCCAGACATCGAGACGGAACCGTCCCCTTC
GGCTCGGGCGTCGGCCCAGGCGCTCTTGGCAGCAGAGGAAAAAACCCAACCGGCTCCGGCTTTATTCCCACCAGC
CTACAGGGTCAAGTTGACCAAGGCGCTGACGGCCGAGGTAGAGCGGATCGCCTCCAAGCAGTCTTCGGTTCCGCT
CCCGCTGTCACGGTACGAAGCGCAGGAGCCGCCGGCGTCGGATGCGGTCCGTCCCGCGCTGGAGGCTGCTTACGT
CTCGGCTGCCTATCTTGCTGCGCGGGCGAGGAATCTCGATTTGTTGGATTCGTATGGGCCCAATGCTTGGCTGTT
GCATAATTATCATCTGGATTCGTTGCGGCAGAGACTCGATTCCCAGAGAGCTGCCGTCGCGGCTGATATCGATGT
CGTCAATGCCCGCAGGCAGGCTCTTCAGATGGACGCCAAGCCAGAGTTGGACGCCTTGGAGGCCGAGTGGAAGAG
GACGCTGGCTCAGGTGCTCGAGACGGAACTCGACGTTTGTCGCTTAGAGGCTCAGATTCGTCGTCAGCGTCGCGC
CCTCGTCGCTCAACACTCGGACACGCCCACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail