Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1026
Gene name
Locationscaffold_131:1731..4174
Strand+
Gene length (bp)2443
Transcript length (bp)2358
Coding sequence length (bp)2355
Protein length (aa) 785

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04042 DNA_pol_E_B DNA polymerase alpha/epsilon subunit B 5.7E-60 460 744

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24482|DPB2_YEAST DNA polymerase epsilon subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPB2 PE=1 SV=3 47 772 3.0E-87
sp|O94263|DPB2_SCHPO DNA polymerase epsilon subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpb2 PE=1 SV=1 54 760 3.0E-82
sp|Q6BQR8|DPB2_DEBHA DNA polymerase epsilon subunit B OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPB2 PE=3 SV=1 48 772 4.0E-77
sp|Q758V1|DPB2_ASHGO DNA polymerase epsilon subunit B OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPB2 PE=3 SV=1 44 766 7.0E-74
sp|Q6FSK8|DPB2_CANGA DNA polymerase epsilon subunit B OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DPB2 PE=3 SV=1 47 773 3.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24482|DPB2_YEAST DNA polymerase epsilon subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPB2 PE=1 SV=3 47 772 3.0E-87
sp|O94263|DPB2_SCHPO DNA polymerase epsilon subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpb2 PE=1 SV=1 54 760 3.0E-82
sp|Q6BQR8|DPB2_DEBHA DNA polymerase epsilon subunit B OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPB2 PE=3 SV=1 48 772 4.0E-77
sp|Q758V1|DPB2_ASHGO DNA polymerase epsilon subunit B OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPB2 PE=3 SV=1 44 766 7.0E-74
sp|Q6FSK8|DPB2_CANGA DNA polymerase epsilon subunit B OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DPB2 PE=3 SV=1 47 773 3.0E-73
sp|Q6CPH8|DPB2_KLULA DNA polymerase epsilon subunit B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DPB2 PE=3 SV=1 46 772 1.0E-71
sp|Q6C030|DPB2_YARLI DNA polymerase epsilon subunit B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPB2 PE=3 SV=1 46 773 3.0E-69
sp|P0CN24|DPB2_CRYNJ DNA polymerase epsilon subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DPB2 PE=3 SV=1 189 759 3.0E-49
sp|P0CN25|DPB2_CRYNB DNA polymerase epsilon subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DPB2 PE=3 SV=1 189 759 3.0E-49
sp|O54956|DPOE2_MOUSE DNA polymerase epsilon subunit 2 OS=Mus musculus GN=Pole2 PE=2 SV=2 208 758 1.0E-36
sp|A7YWS7|DPOE2_BOVIN DNA polymerase epsilon subunit 2 OS=Bos taurus GN=POLE2 PE=2 SV=1 185 758 2.0E-35
sp|P56282|DPOE2_HUMAN DNA polymerase epsilon subunit 2 OS=Homo sapiens GN=POLE2 PE=1 SV=2 208 758 4.0E-35
sp|Q5ZKQ6|DPOE2_CHICK DNA polymerase epsilon subunit 2 OS=Gallus gallus GN=POLE2 PE=2 SV=1 208 758 4.0E-33
sp|Q54Y85|DPOE2_DICDI DNA polymerase epsilon subunit 2 OS=Dictyostelium discoideum GN=pole2 PE=3 SV=1 200 758 2.0E-28
[Show less]

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0003677 DNA binding Yes
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1026
MEKTPAPIFRKPRAVPASSALPSSSPAFGTPIHPLKPFNVAAPKAAILPIILPPATLRPLAFRTFTKKHALTLTS
SALQELASFIGRHCGSGWREEGLADRVLEEAARGWKNRNGGAIVEGSSKELHDILKTLEGNMSGGKVVGPGRGLP
RGDSMLLVRDGDAVNARLGLRPTTLERDDSNASFGVSALGVGEEADEDDDSNDARAWLTVINAYEQPRLVFNVNK
KHFERETTKPSLFPPASHKTTAFRNRYHVIHQRLLRSEAFQTSTVSSSRNRSLQPSLSSPQSLKLTPIANMLGRH
GSNHMLLGQLVLLPTGDLAISDLSGTIALDLGQAVAIPDDSAWFCPGMVVLVDGLYEENSESAGRALGGGCGVGG
TLGGRFRGFFIGQPPCEKRMVTLGISGPDGGQHHTIGGGFGWIDFLGVGSERAVGAKMRRLERRLLDPSPLPSAS
ADPSPGRNRVVILGELNLDRPRALQALRKVLSLYAAEPEGASPVCFVVAGSFVQQAVMAGGGSGGSIEYKEYFDT
LASALADFPTLLQTSTFVFVPGDNDGWVSALAAGASVPLPRRPVPDMFTSRVRRAFATANAEAGRHGVPGSAVWT
SNPSRLTLFGPSHEMVLFRDDLSARLRRNCVALKRSDAQDAAPAATESKSHTEPVTPSDDAMELDKANVNEEEEE
EEEEAASCPSAAEDMRTAQKLVKTLLDQGFLAPFRPAVRPVHWDYASSLHLYPLPSALVLVDATAPPFCLSYGAC
HVMNPGSLLVPGKRAVARWIDYEVGRLGTLRHCTF
Coding >Ophio5|1026
ATGGAAAAGACTCCCGCCCCCATCTTCCGCAAGCCAAGGGCCGTCCCAGCCTCGTCGGCACTGCCCTCATCATCA
CCCGCCTTCGGCACGCCCATCCATCCCCTGAAGCCCTTCAACGTCGCCGCGCCCAAAGCCGCCATCCTACCCATC
ATCCTGCCTCCCGCCACGCTTCGACCCCTCGCCTTCCGAACCTTCACCAAGAAGCATGCCCTGACGCTCACGTCG
TCGGCGCTGCAGGAACTCGCCTCCTTCATCGGCCGCCACTGCGGCTCGGGATGGCGAGAGGAGGGTCTGGCGGAT
CGTGTTCTTGAAGAGGCTGCCAGGGGTTGGAAGAATAGAAATGGCGGCGCCATCGTTGAAGGCTCCAGCAAGGAG
CTGCATGACATTCTCAAGACGTTGGAGGGGAACATGAGCGGCGGCAAGGTCGTCGGTCCGGGGAGAGGCCTCCCC
CGCGGAGATAGCATGCTACTTGTCCGGGATGGCGACGCCGTCAATGCGAGGCTGGGTCTGCGGCCGACGACGCTC
GAGAGAGACGACAGCAATGCCAGCTTTGGTGTCTCTGCTTTGGGTGTGGGGGAGGAGGCTGATGAGGACGACGAC
AGCAACGATGCGCGCGCGTGGCTCACCGTCATCAATGCCTACGAACAACCGAGGCTAGTCTTCAACGTCAACAAG
AAGCATTTCGAGAGAGAGACGACGAAGCCGTCGCTATTCCCGCCCGCCTCTCACAAAACGACGGCCTTCCGCAAC
CGCTACCACGTCATCCATCAGCGTCTTCTCCGCAGCGAAGCCTTCCAAACGTCAACCGTCTCCTCCTCCCGCAAC
CGCTCTCTTCAACCCTCCCTCTCGAGCCCCCAATCTCTCAAGCTCACGCCCATAGCCAACATGCTCGGCCGCCAC
GGCAGCAACCATATGCTCCTCGGTCAGCTCGTCCTCTTACCGACGGGCGACCTAGCCATCAGCGACCTTAGCGGC
ACCATCGCCCTCGACCTCGGACAGGCCGTCGCCATACCCGACGACTCAGCCTGGTTCTGTCCCGGCATGGTGGTC
CTCGTCGACGGCCTGTACGAGGAGAACTCGGAGTCGGCGGGCAGGGCCCTCGGCGGCGGCTGCGGCGTAGGAGGT
ACGCTTGGAGGTCGCTTTCGGGGGTTCTTCATCGGCCAGCCGCCGTGTGAGAAGCGGATGGTGACGCTCGGCATC
AGTGGACCGGATGGCGGACAGCATCACACCATCGGCGGTGGCTTCGGCTGGATAGACTTTCTCGGCGTCGGCAGC
GAGCGCGCCGTAGGAGCCAAGATGCGTCGTCTGGAGCGCCGCCTCCTGGATCCTTCCCCCCTCCCATCAGCCTCG
GCCGACCCCTCGCCAGGCCGCAACCGGGTCGTCATCCTGGGCGAGCTGAACCTGGACCGTCCGCGCGCGCTACAG
GCCCTCCGCAAGGTGCTATCGTTGTACGCAGCCGAGCCCGAAGGCGCGTCTCCCGTCTGCTTCGTCGTGGCCGGT
AGCTTCGTCCAGCAAGCCGTCATGGCCGGCGGCGGAAGCGGAGGCAGCATCGAGTACAAGGAATATTTCGATACC
TTGGCCTCGGCCCTCGCCGACTTCCCGACCCTGCTCCAGACGAGCACCTTTGTCTTCGTCCCCGGCGACAACGAC
GGCTGGGTCTCGGCCTTGGCTGCCGGTGCCTCTGTGCCTCTCCCCCGAAGACCGGTCCCGGACATGTTCACCTCA
CGCGTTCGTCGGGCCTTTGCCACTGCCAACGCCGAGGCTGGCCGGCACGGCGTCCCGGGCTCGGCCGTATGGACG
TCTAATCCCAGCCGCCTCACGCTCTTCGGCCCCAGCCACGAGATGGTTCTCTTCCGCGATGATCTATCGGCCCGG
TTACGTCGCAACTGCGTCGCCCTGAAGCGTAGCGACGCCCAAGACGCGGCGCCGGCCGCTACCGAGTCAAAATCC
CATACCGAGCCAGTGACGCCCTCGGATGATGCCATGGAGCTCGACAAGGCCAACGTAAACGAAGAAGAAGAAGAA
GAAGAGGAGGAGGCGGCATCTTGCCCATCCGCGGCCGAAGACATGCGCACGGCACAAAAGCTCGTCAAGACTCTC
CTCGACCAAGGTTTCCTCGCCCCATTTCGCCCAGCCGTACGCCCCGTTCACTGGGATTACGCCTCGTCGCTACAT
CTCTACCCGCTGCCCTCGGCCTTGGTCCTCGTCGACGCCACCGCGCCACCCTTTTGTCTCTCCTACGGGGCCTGC
CACGTCATGAACCCCGGAAGCCTCCTCGTTCCCGGGAAAAGGGCCGTCGCTAGGTGGATTGACTACGAGGTCGGT
CGTCTCGGCACGCTGCGTCACTGTACCTTT
Transcript >Ophio5|1026
ATGGAAAAGACTCCCGCCCCCATCTTCCGCAAGCCAAGGGCCGTCCCAGCCTCGTCGGCACTGCCCTCATCATCA
CCCGCCTTCGGCACGCCCATCCATCCCCTGAAGCCCTTCAACGTCGCCGCGCCCAAAGCCGCCATCCTACCCATC
ATCCTGCCTCCCGCCACGCTTCGACCCCTCGCCTTCCGAACCTTCACCAAGAAGCATGCCCTGACGCTCACGTCG
TCGGCGCTGCAGGAACTCGCCTCCTTCATCGGCCGCCACTGCGGCTCGGGATGGCGAGAGGAGGGTCTGGCGGAT
CGTGTTCTTGAAGAGGCTGCCAGGGGTTGGAAGAATAGAAATGGCGGCGCCATCGTTGAAGGCTCCAGCAAGGAG
CTGCATGACATTCTCAAGACGTTGGAGGGGAACATGAGCGGCGGCAAGGTCGTCGGTCCGGGGAGAGGCCTCCCC
CGCGGAGATAGCATGCTACTTGTCCGGGATGGCGACGCCGTCAATGCGAGGCTGGGTCTGCGGCCGACGACGCTC
GAGAGAGACGACAGCAATGCCAGCTTTGGTGTCTCTGCTTTGGGTGTGGGGGAGGAGGCTGATGAGGACGACGAC
AGCAACGATGCGCGCGCGTGGCTCACCGTCATCAATGCCTACGAACAACCGAGGCTAGTCTTCAACGTCAACAAG
AAGCATTTCGAGAGAGAGACGACGAAGCCGTCGCTATTCCCGCCCGCCTCTCACAAAACGACGGCCTTCCGCAAC
CGCTACCACGTCATCCATCAGCGTCTTCTCCGCAGCGAAGCCTTCCAAACGTCAACCGTCTCCTCCTCCCGCAAC
CGCTCTCTTCAACCCTCCCTCTCGAGCCCCCAATCTCTCAAGCTCACGCCCATAGCCAACATGCTCGGCCGCCAC
GGCAGCAACCATATGCTCCTCGGTCAGCTCGTCCTCTTACCGACGGGCGACCTAGCCATCAGCGACCTTAGCGGC
ACCATCGCCCTCGACCTCGGACAGGCCGTCGCCATACCCGACGACTCAGCCTGGTTCTGTCCCGGCATGGTGGTC
CTCGTCGACGGCCTGTACGAGGAGAACTCGGAGTCGGCGGGCAGGGCCCTCGGCGGCGGCTGCGGCGTAGGAGGT
ACGCTTGGAGGTCGCTTTCGGGGGTTCTTCATCGGCCAGCCGCCGTGTGAGAAGCGGATGGTGACGCTCGGCATC
AGTGGACCGGATGGCGGACAGCATCACACCATCGGCGGTGGCTTCGGCTGGATAGACTTTCTCGGCGTCGGCAGC
GAGCGCGCCGTAGGAGCCAAGATGCGTCGTCTGGAGCGCCGCCTCCTGGATCCTTCCCCCCTCCCATCAGCCTCG
GCCGACCCCTCGCCAGGCCGCAACCGGGTCGTCATCCTGGGCGAGCTGAACCTGGACCGTCCGCGCGCGCTACAG
GCCCTCCGCAAGGTGCTATCGTTGTACGCAGCCGAGCCCGAAGGCGCGTCTCCCGTCTGCTTCGTCGTGGCCGGT
AGCTTCGTCCAGCAAGCCGTCATGGCCGGCGGCGGAAGCGGAGGCAGCATCGAGTACAAGGAATATTTCGATACC
TTGGCCTCGGCCCTCGCCGACTTCCCGACCCTGCTCCAGACGAGCACCTTTGTCTTCGTCCCCGGCGACAACGAC
GGCTGGGTCTCGGCCTTGGCTGCCGGTGCCTCTGTGCCTCTCCCCCGAAGACCGGTCCCGGACATGTTCACCTCA
CGCGTTCGTCGGGCCTTTGCCACTGCCAACGCCGAGGCTGGCCGGCACGGCGTCCCGGGCTCGGCCGTATGGACG
TCTAATCCCAGCCGCCTCACGCTCTTCGGCCCCAGCCACGAGATGGTTCTCTTCCGCGATGATCTATCGGCCCGG
TTACGTCGCAACTGCGTCGCCCTGAAGCGTAGCGACGCCCAAGACGCGGCGCCGGCCGCTACCGAGTCAAAATCC
CATACCGAGCCAGTGACGCCCTCGGATGATGCCATGGAGCTCGACAAGGCCAACGTAAACGAAGAAGAAGAAGAA
GAAGAGGAGGAGGCGGCATCTTGCCCATCCGCGGCCGAAGACATGCGCACGGCACAAAAGCTCGTCAAGACTCTC
CTCGACCAAGGTTTCCTCGCCCCATTTCGCCCAGCCGTACGCCCCGTTCACTGGGATTACGCCTCGTCGCTACAT
CTCTACCCGCTGCCCTCGGCCTTGGTCCTCGTCGACGCCACCGCGCCACCCTTTTGTCTCTCCTACGGGGCCTGC
CACGTCATGAACCCCGGAAGCCTCCTCGTTCCCGGGAAAAGGGCCGTCGCTAGGTGGATTGACTACGAGGTCGGT
CGTCTCGGCACGCTGCGTCACTGTACCTTTTAG
Gene >Ophio5|1026
ATGGAAAAGACTCCCGCCCCCATCTTCCGCAAGCCAAGGGCCGTCCCAGCCTCGTCGGCACTGCCCTCATCATCA
CCCGCCTTCGGCACGCCCATCCATCCCCTGAAGCCCTTCAACGTCGCCGCGCCCAAAGCCGCCATCCTACCCATC
ATCCTGCCTCCCGCCACGCTTCGACCCCTCGCCTTCCGAACCTTCACCAAGAAGCATGCCCTGACGCTCACGTCG
TCGGCGCTGCAGGAACTCGCCTCCTTCATCGGCCGCCACTGCGGCTCGGGATGGCGAGAGGAGGGTCTGGCGGAT
CGTGTTCTTGAAGAGGCTGCCAGGGGTTGGAAGAATAGAAATGGCGGCGCCATCGTTGAAGGCTCCAGCAAGGAG
CTGCATGACATTCTCAAGACGTTGGAGGGGAACATGAGCGGCGGCAAGGTCGTCGGTCCGGGGAGAGGCCTCCCC
CGCGGAGATAGCATGCTACTTGTCCGGGATGGCGACGCCGTCAATGCGAGGCTGGGTCTGCGGCCGACGACGCTC
GAGAGAGACGACAGCAATGCCAGCTTTGGTGTCTCTGCTTTGGGTGTGGGGGAGGAGGCTGATGAGGACGACGAC
AGCAACGATGCGCGCGCGTGGCTCACCGTCATCAATGCCTACGAACAACCGAGGCTAGTCTTCAACGTCAACAAG
AAGCATTTCGAGAGGTACCGTACCGCTCTTGATACTCATTACTTGTTTTCATCGGGCCTCGGCGAGGAGGCAATG
GCTGATGATGTTGTCTGTCTACAGAGAGACGACGAAGCCGTCGCTATTCCCGCCCGCCTCTCACAAAACGACGGC
CTTCCGCAACCGCTACCACGTCATCCATCAGCGTCTTCTCCGCAGCGAAGCCTTCCAAACGTCAACCGTCTCCTC
CTCCCGCAACCGCTCTCTTCAACCCTCCCTCTCGAGCCCCCAATCTCTCAAGCTCACGCCCATAGCCAACATGCT
CGGCCGCCACGGCAGCAACCATATGCTCCTCGGTCAGCTCGTCCTCTTACCGACGGGCGACCTAGCCATCAGCGA
CCTTAGCGGCACCATCGCCCTCGACCTCGGACAGGCCGTCGCCATACCCGACGACTCAGCCTGGTTCTGTCCCGG
CATGGTGGTCCTCGTCGACGGCCTGTACGAGGAGAACTCGGAGTCGGCGGGCAGGGCCCTCGGCGGCGGCTGCGG
CGTAGGAGGTACGCTTGGAGGTCGCTTTCGGGGGTTCTTCATCGGCCAGCCGCCGTGTGAGAAGCGGATGGTGAC
GCTCGGCATCAGTGGACCGGATGGCGGACAGCATCACACCATCGGCGGTGGCTTCGGCTGGATAGACTTTCTCGG
CGTCGGCAGCGAGCGCGCCGTAGGAGCCAAGATGCGTCGTCTGGAGCGCCGCCTCCTGGATCCTTCCCCCCTCCC
ATCAGCCTCGGCCGACCCCTCGCCAGGCCGCAACCGGGTCGTCATCCTGGGCGAGCTGAACCTGGACCGTCCGCG
CGCGCTACAGGCCCTCCGCAAGGTGCTATCGTTGTACGCAGCCGAGCCCGAAGGCGCGTCTCCCGTCTGCTTCGT
CGTGGCCGGTAGCTTCGTCCAGCAAGCCGTCATGGCCGGCGGCGGAAGCGGAGGCAGCATCGAGTACAAGGAATA
TTTCGATACCTTGGCCTCGGCCCTCGCCGACTTCCCGACCCTGCTCCAGACGAGCACCTTTGTCTTCGTCCCCGG
CGACAACGACGGCTGGGTCTCGGCCTTGGCTGCCGGTGCCTCTGTGCCTCTCCCCCGAAGACCGGTCCCGGACAT
GTTCACCTCACGCGTTCGTCGGGCCTTTGCCACTGCCAACGCCGAGGCTGGCCGGCACGGCGTCCCGGGCTCGGC
CGTATGGACGTCTAATCCCAGCCGCCTCACGCTCTTCGGCCCCAGCCACGAGATGGTTCTCTTCCGCGATGATCT
ATCGGCCCGGTTACGTCGCAACTGCGTCGCCCTGAAGCGTAGCGACGCCCAAGACGCGGCGCCGGCCGCTACCGA
GTCAAAATCCCATACCGAGCCAGTGACGCCCTCGGATGATGCCATGGAGCTCGACAAGGCCAACGTAAACGAAGA
AGAAGAAGAAGAAGAGGAGGAGGCGGCATCTTGCCCATCCGCGGCCGAAGACATGCGCACGGCACAAAAGCTCGT
CAAGACTCTCCTCGACCAAGGTTTCCTCGCCCCATTTCGCCCAGCCGTACGCCCCGTTCACTGGGATTACGCCTC
GTCGCTACATCTCTACCCGCTGCCCTCGGCCTTGGTCCTCGTCGACGCCACCGCGCCACCCTTTTGTCTCTCCTA
CGGGGCCTGCCACGTCATGAACCCCGGAAGCCTCCTCGTTCCCGGGAAAAGGGCCGTCGCTAGGTGGATTGACTA
CGAGGTCGGTCGTCTCGGCACGCTGCGTCACTGTACCTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail