Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1024
Gene name
Locationscaffold_1307:519..1829
Strand+
Gene length (bp)1310
Transcript length (bp)972
Coding sequence length (bp)969
Protein length (aa) 323

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08569 Mo25 Mo25-like 4.0E-57 3 230
PF08569 Mo25 Mo25-like 4.0E-26 229 314

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60032|HYMA_EMENI Conidiophore development protein hymA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hymA PE=3 SV=1 1 323 5.0E-115
sp|Q9H9S4|CB39L_HUMAN Calcium-binding protein 39-like OS=Homo sapiens GN=CAB39L PE=1 SV=3 4 317 4.0E-44
sp|Q9P7Q8|PMO25_SCHPO Mo25-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmo25 PE=3 SV=1 1 314 2.0E-43
sp|Q9DB16|CB39L_MOUSE Calcium-binding protein 39-like OS=Mus musculus GN=Cab39l PE=1 SV=3 4 314 3.0E-43
sp|Q9Y376|CAB39_HUMAN Calcium-binding protein 39 OS=Homo sapiens GN=CAB39 PE=1 SV=1 1 314 3.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60032|HYMA_EMENI Conidiophore development protein hymA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hymA PE=3 SV=1 1 323 5.0E-115
sp|Q9H9S4|CB39L_HUMAN Calcium-binding protein 39-like OS=Homo sapiens GN=CAB39L PE=1 SV=3 4 317 4.0E-44
sp|Q9P7Q8|PMO25_SCHPO Mo25-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmo25 PE=3 SV=1 1 314 2.0E-43
sp|Q9DB16|CB39L_MOUSE Calcium-binding protein 39-like OS=Mus musculus GN=Cab39l PE=1 SV=3 4 314 3.0E-43
sp|Q9Y376|CAB39_HUMAN Calcium-binding protein 39 OS=Homo sapiens GN=CAB39 PE=1 SV=1 1 314 3.0E-39
sp|Q29RI6|CAB39_BOVIN Calcium-binding protein 39 OS=Bos taurus GN=CAB39 PE=2 SV=1 1 314 3.0E-39
sp|Q06138|CAB39_MOUSE Calcium-binding protein 39 OS=Mus musculus GN=Cab39 PE=1 SV=2 1 314 4.0E-39
sp|O18211|MO25M_CAEEL MO25-like protein 2 OS=Caenorhabditis elegans GN=mop-25.2 PE=3 SV=1 4 314 2.0E-36
sp|P91891|MO25_DROME Protein Mo25 OS=Drosophila melanogaster GN=Mo25 PE=2 SV=2 4 318 2.0E-32
sp|Q9FGK3|MO25N_ARATH Putative MO25-like protein At5g47540 OS=Arabidopsis thaliana GN=At5g47540 PE=2 SV=1 35 311 9.0E-28
sp|Q9M0M4|MO25M_ARATH Putative MO25-like protein At4g17270 OS=Arabidopsis thaliana GN=At4g17270 PE=2 SV=1 7 314 4.0E-25
sp|Q9XFY6|DEE76_AUXPR Degreening-related gene dee76 protein OS=Auxenochlorella protothecoides GN=DEE76 PE=2 SV=1 18 316 3.0E-24
sp|Q9ZQ77|MO25L_ARATH MO25-like protein At2g03410 OS=Arabidopsis thaliana GN=At2g03410 PE=2 SV=1 38 315 4.0E-18
sp|P32464|HYM1_YEAST Protein HYM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HYM1 PE=1 SV=1 1 314 2.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1024
MSFLFGRARGRAVADLSKQAYENISRLDGPNGAAKAEELVRVLNQMKLVLQGTNETDSSPEQIHQLVTGLIDEDL
LYLLANNLYRLPFESRKDTQVIFSYVFRFRTAAAANKSDPIALSYVVSNRPQVLIELCQAYEHKESATPAGSVLR
ELLKNEDAASIILHDDGDEPGSSAKGLNSIDRERPQSGRGVFWRFFDWIDKSSFEVAADAFTTFRELLTRHKDLV
PRYLSLLGEILLDRSNYSVMTAYVDRGDHLKICMNLLRDDRKMSIAVQKILLMNREKLLNFLAHFLEDRTDDEQF
IDEREFLVKQIKNMSSTPIPPKR
Coding >Ophio5|1024
ATGTCATTTTTGTTTGGTCGAGCTCGCGGACGAGCAGTCGCCGACTTGTCAAAGCAAGCATATGAAAATATTTCA
AGACTCGATGGCCCGAACGGAGCCGCAAAGGCTGAGGAGCTGGTTCGCGTCCTTAACCAGATGAAGCTTGTCCTG
CAGGGCACCAACGAAACCGACAGCTCTCCTGAACAGATACACCAACTTGTGACCGGTCTCATCGATGAAGATTTA
CTCTATCTTCTGGCTAACAATCTCTACCGCTTGCCCTTCGAATCACGGAAAGACACACAAGTCATCTTTTCCTAT
GTATTCAGATTTCGGACTGCCGCTGCAGCCAACAAAAGCGACCCGATAGCCCTGTCTTACGTTGTGAGCAATCGA
CCACAGGTGCTCATCGAGTTGTGTCAAGCCTATGAACACAAAGAAAGCGCCACTCCGGCTGGCTCAGTACTTCGC
GAGCTGCTGAAAAACGAGGATGCCGCGTCTATCATTCTACATGATGACGGTGACGAACCTGGTTCCAGTGCCAAG
GGCCTCAACTCTATCGACCGCGAAAGACCTCAGAGTGGCCGAGGCGTCTTTTGGAGGTTTTTTGATTGGATTGAC
AAAAGCTCGTTCGAAGTCGCCGCTGACGCTTTTACCACTTTTCGAGAGCTACTCACACGCCACAAAGACTTGGTT
CCCCGCTATCTTTCCCTTCTGGGCGAAATTCTGCTAGACCGCTCCAACTACAGTGTTATGACGGCATATGTTGAT
AGGGGCGACCATCTCAAGATATGCATGAACTTGTTACGCGATGACAGGAAGATGTCAATTGCTGTCCAGAAAATA
TTGCTTATGAACCGGGAGAAACTCTTGAACTTTCTCGCTCATTTCCTCGAAGACCGCACAGATGACGAGCAGTTC
ATCGACGAGCGAGAATTCCTCGTAAAGCAAATCAAAAATATGTCGTCTACCCCCATACCGCCGAAGCGC
Transcript >Ophio5|1024
ATGTCATTTTTGTTTGGTCGAGCTCGCGGACGAGCAGTCGCCGACTTGTCAAAGCAAGCATATGAAAATATTTCA
AGACTCGATGGCCCGAACGGAGCCGCAAAGGCTGAGGAGCTGGTTCGCGTCCTTAACCAGATGAAGCTTGTCCTG
CAGGGCACCAACGAAACCGACAGCTCTCCTGAACAGATACACCAACTTGTGACCGGTCTCATCGATGAAGATTTA
CTCTATCTTCTGGCTAACAATCTCTACCGCTTGCCCTTCGAATCACGGAAAGACACACAAGTCATCTTTTCCTAT
GTATTCAGATTTCGGACTGCCGCTGCAGCCAACAAAAGCGACCCGATAGCCCTGTCTTACGTTGTGAGCAATCGA
CCACAGGTGCTCATCGAGTTGTGTCAAGCCTATGAACACAAAGAAAGCGCCACTCCGGCTGGCTCAGTACTTCGC
GAGCTGCTGAAAAACGAGGATGCCGCGTCTATCATTCTACATGATGACGGTGACGAACCTGGTTCCAGTGCCAAG
GGCCTCAACTCTATCGACCGCGAAAGACCTCAGAGTGGCCGAGGCGTCTTTTGGAGGTTTTTTGATTGGATTGAC
AAAAGCTCGTTCGAAGTCGCCGCTGACGCTTTTACCACTTTTCGAGAGCTACTCACACGCCACAAAGACTTGGTT
CCCCGCTATCTTTCCCTTCTGGGCGAAATTCTGCTAGACCGCTCCAACTACAGTGTTATGACGGCATATGTTGAT
AGGGGCGACCATCTCAAGATATGCATGAACTTGTTACGCGATGACAGGAAGATGTCAATTGCTGTCCAGAAAATA
TTGCTTATGAACCGGGAGAAACTCTTGAACTTTCTCGCTCATTTCCTCGAAGACCGCACAGATGACGAGCAGTTC
ATCGACGAGCGAGAATTCCTCGTAAAGCAAATCAAAAATATGTCGTCTACCCCCATACCGCCGAAGCGCTAG
Gene >Ophio5|1024
ATGTCATTTTTGTTTGGTCGAGCTCGCGGACGAGCAGTCGCCGACTTGTCAAAGCAAGCATATGAAAATATTTCA
AGACTCGATGGCCCGAACGGAGCCGCAAAGGTGCGATTGTTGTCCTAGACTTGTTAACATGACCACTGACTGGCT
CGTCAGGCTGAGGAGCTGGTTCGCGTCCTTAACCAGATGAAGCTTGTCCTGCAGGGCACCAACGGTCAGTCCACC
TTTGTCTTCTCCCGGGCATTACTTCATCCACTCCTCGAACGCAAACTCACTTGTGCCATGTCAAGCAGAAACCGA
CAGCTCTCCTGAACAGATACACCAACTTGTGACCGGTCTCATCGATGAAGATTTACTCTATCTTCTGGCTAACAA
TCTCTACCGCTTGCCCTTCGAATCACGGAAAGACACACAAGTCATCTTTTCCTATGTATTCAGATTTCGGACTGC
CGCTGCAGCCAACAAAAGCGACCCGATAGCCCTGTCTTACGTTGTGAGCAATCGACCACAGGTGCTCATCGAGTT
GTGTCAAGCCTATGAACACAAAGAAAGCGCCACTCCGGCTGGCTCAGTACTTCGCGAGCTGCTGAAAAACGAGGA
TGCCGCGTCTATCATTCTACATGATGACGGTGACGAACCTGGTTCCAGTGCCAAGGGCCTCAACTCTATCGACCG
CGAAAGACCTCAGAGTGGCCGAGGCGTCTTTTGGAGGTTTTTTGATTGGATTGACAAAAGCTCGTTCGAAGTCGC
CGCTGACGCTTTTACCACTTTTCGAGCAAGTGCACCATTCCCTGACGTTGCGACAGACGGGAGACATGCAGCTAA
CAGTAAGCAATGTCCCTCAGGAGCTACTCACACGCCACAAAGACTTGGTTCCCCGCTATCTTTCCGTAAATTTCG
ACCTTTTCTTCGATAAATACAACAGTGTCCTCGTACAATCTAACAGTTACGTCACTAAACGACAATCTATCAAGC
TTCTGGGCGAAATTCTGCTAGACCGCTCCAACTACAGTGTTATGACGGCATATGTTGATAGGGGCGACCATCTCA
AGATATGCATGAACTTGTTACGCGATGACAGGAAGATGGTACAGTACGAGGGATTCCACGTGTTCAAGGTTTTTG
TTGCCAATCCGCATAAGTCAATTGCTGTCCAGAAAATATTGCTTATGAACCGGGAGAAACTCTTGAACTTTCTCG
CTCATTTCCTCGAAGACCGCACAGATGACGAGCAGTTCATCGACGAGCGAGAATTCCTCGTAAAGCAAATCAAAA
ATATGTCGTCTACCCCCATACCGCCGAAGCGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail