Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1017
Gene name
Locationscaffold_130:34489..35838
Strand-
Gene length (bp)1349
Transcript length (bp)1272
Coding sequence length (bp)1269
Protein length (aa) 423

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03388 Lectin_leg-like Legume-like lectin family 3.2E-24 60 237

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43555|EMP47_YEAST Protein EMP47 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP47 PE=1 SV=1 44 235 6.0E-15
sp|Q62902|LMAN1_RAT Protein ERGIC-53 OS=Rattus norvegicus GN=Lman1 PE=1 SV=1 69 423 6.0E-11
sp|P49257|LMAN1_HUMAN Protein ERGIC-53 OS=Homo sapiens GN=LMAN1 PE=1 SV=2 69 423 8.0E-11
sp|Q9TU32|LMAN1_CHLAE Protein ERGIC-53 OS=Chlorocebus aethiops GN=LMAN1 PE=2 SV=1 69 423 1.0E-10
sp|Q12396|EMP46_YEAST Protein EMP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP46 PE=1 SV=1 58 373 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43555|EMP47_YEAST Protein EMP47 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP47 PE=1 SV=1 44 235 6.0E-15
sp|Q62902|LMAN1_RAT Protein ERGIC-53 OS=Rattus norvegicus GN=Lman1 PE=1 SV=1 69 423 6.0E-11
sp|P49257|LMAN1_HUMAN Protein ERGIC-53 OS=Homo sapiens GN=LMAN1 PE=1 SV=2 69 423 8.0E-11
sp|Q9TU32|LMAN1_CHLAE Protein ERGIC-53 OS=Chlorocebus aethiops GN=LMAN1 PE=2 SV=1 69 423 1.0E-10
sp|Q12396|EMP46_YEAST Protein EMP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP46 PE=1 SV=1 58 373 1.0E-10
sp|Q9HAT1|LMA1L_HUMAN Protein ERGIC-53-like OS=Homo sapiens GN=LMAN1L PE=2 SV=2 62 248 2.0E-09
sp|Q2HJD1|LMA2L_BOVIN VIP36-like protein OS=Bos taurus GN=LMAN2L PE=2 SV=1 59 260 3.0E-07
sp|P59481|LMA2L_MOUSE VIP36-like protein OS=Mus musculus GN=Lman2l PE=1 SV=1 59 235 3.0E-07
sp|Q8VCD3|LMA1L_MOUSE Protein ERGIC-53-like OS=Mus musculus GN=Lman1l PE=2 SV=2 73 223 6.0E-07
sp|Q5RCF0|LMA2L_PONAB VIP36-like protein OS=Pongo abelii GN=LMAN2L PE=3 SV=1 59 260 9.0E-07
sp|Q9H0V9|LMA2L_HUMAN VIP36-like protein OS=Homo sapiens GN=LMAN2L PE=1 SV=1 59 246 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 393 411 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1017
MRAPAFCAVLAALFAASEAADAKAIEELSFGQSGRLNPDGSPGRVPHFTLSGHPHQPELLSNKIILTPVAPGNQR
GALWADNPLARSFWSAHIDFRANGPERGGGNLNVWLVHGGSSVVGSNSIYTVGKFDGLGVVIDAHGRSGGMVRGF
LNDGTVDYAQQHDIDRLAFGHCQYAYRNLGRPSRLSLVQTAHSFRVEVDSRLCFETEKASLPSGNFLGITAATPD
TPDSFELFSMVVSSDSTQDIPPHHAQQKQPAPPAAAAAPDAPHYNQPADESADHFTTSAAQFRDLHDRLQGLTHH
LASISAEIANYDHHSNLRNDQVNKALDALRSRLPAGADLIARVKDLEMEVRAMRNDINKKLSSHHDSFQDYLSEH
HDSLTEAMVHHMPGHGKIIFVVVASQVVFALGYVLYKRRKASSPKKYL
Coding >Ophio5|1017
ATGCGAGCCCCGGCCTTCTGTGCCGTGCTGGCCGCGCTCTTCGCCGCGAGCGAGGCGGCCGATGCAAAGGCCATT
GAAGAGCTCAGCTTCGGCCAGTCAGGACGACTCAATCCCGACGGCAGCCCCGGCCGCGTTCCGCATTTCACCCTC
TCCGGCCACCCGCACCAACCCGAGCTACTCTCCAACAAAATCATACTTACGCCCGTCGCGCCGGGGAACCAGCGT
GGCGCACTATGGGCCGACAATCCTCTCGCCCGCTCCTTTTGGTCCGCTCACATCGACTTCCGCGCCAACGGGCCC
GAGCGCGGCGGTGGCAACCTCAACGTCTGGCTCGTTCACGGCGGAAGTTCCGTCGTTGGTTCCAACAGCATCTAC
ACAGTCGGCAAGTTCGATGGCCTCGGTGTCGTCATCGACGCTCATGGTCGCTCCGGCGGCATGGTTCGCGGGTTC
CTGAATGACGGCACCGTCGACTACGCCCAACAGCATGACATCGACCGGCTCGCCTTTGGCCACTGTCAGTACGCC
TATCGCAACCTCGGGCGGCCTTCGCGCCTCAGCCTGGTGCAGACGGCGCACTCGTTCCGCGTCGAGGTCGACAGC
AGGCTGTGCTTCGAAACGGAAAAGGCCAGCCTGCCGTCGGGCAACTTCCTCGGCATCACGGCCGCCACACCCGAC
ACGCCCGACTCGTTTGAGCTCTTCAGCATGGTCGTCTCGTCCGACTCTACCCAAGACATCCCCCCTCATCACGCC
CAACAGAAGCAGCCGGCCCCTCCCGCCGCCGCCGCTGCTCCGGATGCTCCTCACTACAACCAGCCGGCCGACGAG
TCAGCCGACCACTTCACCACGTCAGCCGCCCAGTTCCGCGACCTGCACGATCGTCTGCAGGGCCTCACTCACCAC
TTGGCCTCCATCTCGGCCGAAATCGCCAATTACGATCATCACAGCAACCTGCGCAACGACCAGGTGAACAAGGCG
CTCGACGCCCTGCGGTCACGGCTCCCCGCCGGCGCCGACCTGATCGCGCGCGTCAAGGATCTGGAGATGGAGGTG
CGGGCGATGCGCAACGACATCAACAAGAAGCTATCCTCGCACCACGACTCTTTCCAGGACTACCTGTCTGAACAT
CACGACTCGCTGACCGAGGCCATGGTTCATCACATGCCCGGTCACGGCAAGATCATCTTCGTCGTCGTCGCATCC
CAGGTCGTCTTCGCCCTTGGCTACGTGCTGTATAAGCGACGCAAGGCGAGTAGTCCGAAAAAGTATCTG
Transcript >Ophio5|1017
ATGCGAGCCCCGGCCTTCTGTGCCGTGCTGGCCGCGCTCTTCGCCGCGAGCGAGGCGGCCGATGCAAAGGCCATT
GAAGAGCTCAGCTTCGGCCAGTCAGGACGACTCAATCCCGACGGCAGCCCCGGCCGCGTTCCGCATTTCACCCTC
TCCGGCCACCCGCACCAACCCGAGCTACTCTCCAACAAAATCATACTTACGCCCGTCGCGCCGGGGAACCAGCGT
GGCGCACTATGGGCCGACAATCCTCTCGCCCGCTCCTTTTGGTCCGCTCACATCGACTTCCGCGCCAACGGGCCC
GAGCGCGGCGGTGGCAACCTCAACGTCTGGCTCGTTCACGGCGGAAGTTCCGTCGTTGGTTCCAACAGCATCTAC
ACAGTCGGCAAGTTCGATGGCCTCGGTGTCGTCATCGACGCTCATGGTCGCTCCGGCGGCATGGTTCGCGGGTTC
CTGAATGACGGCACCGTCGACTACGCCCAACAGCATGACATCGACCGGCTCGCCTTTGGCCACTGTCAGTACGCC
TATCGCAACCTCGGGCGGCCTTCGCGCCTCAGCCTGGTGCAGACGGCGCACTCGTTCCGCGTCGAGGTCGACAGC
AGGCTGTGCTTCGAAACGGAAAAGGCCAGCCTGCCGTCGGGCAACTTCCTCGGCATCACGGCCGCCACACCCGAC
ACGCCCGACTCGTTTGAGCTCTTCAGCATGGTCGTCTCGTCCGACTCTACCCAAGACATCCCCCCTCATCACGCC
CAACAGAAGCAGCCGGCCCCTCCCGCCGCCGCCGCTGCTCCGGATGCTCCTCACTACAACCAGCCGGCCGACGAG
TCAGCCGACCACTTCACCACGTCAGCCGCCCAGTTCCGCGACCTGCACGATCGTCTGCAGGGCCTCACTCACCAC
TTGGCCTCCATCTCGGCCGAAATCGCCAATTACGATCATCACAGCAACCTGCGCAACGACCAGGTGAACAAGGCG
CTCGACGCCCTGCGGTCACGGCTCCCCGCCGGCGCCGACCTGATCGCGCGCGTCAAGGATCTGGAGATGGAGGTG
CGGGCGATGCGCAACGACATCAACAAGAAGCTATCCTCGCACCACGACTCTTTCCAGGACTACCTGTCTGAACAT
CACGACTCGCTGACCGAGGCCATGGTTCATCACATGCCCGGTCACGGCAAGATCATCTTCGTCGTCGTCGCATCC
CAGGTCGTCTTCGCCCTTGGCTACGTGCTGTATAAGCGACGCAAGGCGAGTAGTCCGAAAAAGTATCTGTAG
Gene >Ophio5|1017
ATGCGAGCCCCGGCCTTCTGTGCCGTGCTGGCCGCGCTCTTCGCCGCGAGCGAGGCGGCCGATGCAAAGGCCATT
GAAGAGCTCAGCTTCGGCCAGTCAGGACGGTTCGTCACCCGTTTTTTTTTCTTTTTTTTTTCTTTTCCCTCTCCC
GGACGACAAGGCCACTGACGACTTCTCACAGACTCAATCCCGACGGCAGCCCCGGCCGCGTTCCGCATTTCACCC
TCTCCGGCCACCCGCACCAACCCGAGCTACTCTCCAACAAAATCATACTTACGCCCGTCGCGCCGGGGAACCAGC
GTGGCGCACTATGGGCCGACAATCCTCTCGCCCGCTCCTTTTGGTCCGCTCACATCGACTTCCGCGCCAACGGGC
CCGAGCGCGGCGGTGGCAACCTCAACGTCTGGCTCGTTCACGGCGGAAGTTCCGTCGTTGGTTCCAACAGCATCT
ACACAGTCGGCAAGTTCGATGGCCTCGGTGTCGTCATCGACGCTCATGGTCGCTCCGGCGGCATGGTTCGCGGGT
TCCTGAATGACGGCACCGTCGACTACGCCCAACAGCATGACATCGACCGGCTCGCCTTTGGCCACTGTCAGTACG
CCTATCGCAACCTCGGGCGGCCTTCGCGCCTCAGCCTGGTGCAGACGGCGCACTCGTTCCGCGTCGAGGTCGACA
GCAGGCTGTGCTTCGAAACGGAAAAGGCCAGCCTGCCGTCGGGCAACTTCCTCGGCATCACGGCCGCCACACCCG
ACACGCCCGACTCGTTTGAGCTCTTCAGCATGGTCGTCTCGTCCGACTCTACCCAAGACATCCCCCCTCATCACG
CCCAACAGAAGCAGCCGGCCCCTCCCGCCGCCGCCGCTGCTCCGGATGCTCCTCACTACAACCAGCCGGCCGACG
AGTCAGCCGACCACTTCACCACGTCAGCCGCCCAGTTCCGCGACCTGCACGATCGTCTGCAGGGCCTCACTCACC
ACTTGGCCTCCATCTCGGCCGAAATCGCCAATTACGATCATCACAGCAACCTGCGCAACGACCAGGTGAACAAGG
CGCTCGACGCCCTGCGGTCACGGCTCCCCGCCGGCGCCGACCTGATCGCGCGCGTCAAGGATCTGGAGATGGAGG
TGCGGGCGATGCGCAACGACATCAACAAGAAGCTATCCTCGCACCACGACTCTTTCCAGGACTACCTGTCTGAAC
ATCACGACTCGCTGACCGAGGCCATGGTTCATCACATGCCCGGTCACGGCAAGATCATCTTCGTCGTCGTCGCAT
CCCAGGTCGTCTTCGCCCTTGGCTACGTGCTGTATAAGCGACGCAAGGCGAGTAGTCCGAAAAAGTATCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail