Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1012
Gene name
Locationscaffold_130:15651..19179
Strand+
Gene length (bp)3528
Transcript length (bp)3060
Coding sequence length (bp)3057
Protein length (aa) 1019

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 1.1E-23 282 539
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 2.2E-10 75 111

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 267 723 4.0E-76
sp|P39529|YJU6_YEAST Putative transcriptional regulatory protein YJL206C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL206C PE=2 SV=1 264 694 1.0E-55
sp|O60130|YH7G_SCHPO Putative transcriptional regulatory protein C16G5.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.16 PE=1 SV=1 67 688 2.0E-50
sp|O59744|YN28_SCHPO Uncharacterized transcriptional regulatory protein C530.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.08 PE=3 SV=1 77 696 5.0E-49
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 72 577 2.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 267 723 4.0E-76
sp|P39529|YJU6_YEAST Putative transcriptional regulatory protein YJL206C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL206C PE=2 SV=1 264 694 1.0E-55
sp|O60130|YH7G_SCHPO Putative transcriptional regulatory protein C16G5.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.16 PE=1 SV=1 67 688 2.0E-50
sp|O59744|YN28_SCHPO Uncharacterized transcriptional regulatory protein C530.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.08 PE=3 SV=1 77 696 5.0E-49
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 72 577 2.0E-35
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 69 548 1.0E-27
sp|P36598|THI1_SCHPO Thiamine repressible genes regulatory protein thi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi1 PE=1 SV=2 66 692 2.0E-22
sp|O14130|YF54_SCHPO Uncharacterized transcriptional regulatory protein C3C7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.04 PE=3 SV=1 76 649 1.0E-21
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 69 125 8.0E-19
sp|Q59LV8|ASG1_CANAL Activator of stress genes protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASG1 PE=3 SV=1 61 113 1.0E-16
sp|P28348|NIRA_EMENI Nitrogen assimilation transcription factor nirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nirA PE=3 SV=1 61 685 1.0E-16
sp|Q9UTN0|YII3_SCHPO Uncharacterized transcriptional regulatory protein C139.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC139.03 PE=3 SV=1 68 579 7.0E-16
sp|P28349|NIT4_NEUCR Nitrogen assimilation transcription factor nit-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-4 PE=3 SV=2 68 608 8.0E-15
sp|Q09922|YAKB_SCHPO Uncharacterized transcriptional regulatory protein C1F7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F7.11c PE=3 SV=1 69 612 9.0E-12
sp|O74915|YJ74_SCHPO Uncharacterized transcriptional regulatory protein C757.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.04 PE=3 SV=2 76 210 3.0E-10
sp|P10563|QUTA_EMENI Quinic acid utilization activator OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutA PE=3 SV=2 56 138 3.0E-09
sp|Q59NX5|FGR27_CANAL Filamentous growth regulator 27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FGR27 PE=2 SV=1 289 645 3.0E-09
sp|O93870|FCR1_CANAX Fluconazole resistance protein 1 OS=Candida albicans GN=FCR1 PE=3 SV=1 69 155 4.0E-09
sp|G2TRN9|YAOB_SCHPO Uncharacterized transcriptional regulatory protein C11D3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.11c PE=1 SV=1 76 455 5.0E-09
sp|O94490|YC79_SCHPO Uncharacterized transcriptional regulatory protein C417.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.09c PE=3 SV=1 295 651 6.0E-09
sp|P50104|STB4_YEAST Probable transcriptional regulatory protein STB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STB4 PE=1 SV=1 53 113 9.0E-09
sp|P12383|PDR1_YEAST Transcription factor PDR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR1 PE=1 SV=2 49 105 9.0E-09
sp|O94278|THI5_SCHPO Thiamine repressible genes regulatory protein thi5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi5 PE=3 SV=1 66 141 1.0E-08
sp|O42804|XLNR_ASPNG Xylanolytic transcriptional activator xlnR OS=Aspergillus niger GN=xlnR PE=1 SV=2 44 112 2.0E-08
sp|Q0CV52|XLNR_ASPTN Xylanolytic transcriptional activator xlnR OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnR PE=3 SV=2 37 112 3.0E-08
sp|A2R5W7|XLNR_ASPNC Xylanolytic transcriptional activator xlnR OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnR PE=3 SV=2 44 112 3.0E-08
sp|P39113|CAT8_YEAST Regulatory protein CAT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAT8 PE=1 SV=2 55 219 3.0E-08
sp|Q10086|YAO7_SCHPO Uncharacterized transcriptional regulatory protein C11D3.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.07c PE=3 SV=3 295 660 5.0E-08
sp|A1DIC0|XLNR_NEOFI Xylanolytic transcriptional activator xlnR OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnR PE=3 SV=2 37 112 8.0E-08
sp|Q96WP8|XLNR_ASPKA Xylanolytic transcriptional activator xlnR OS=Aspergillus kawachii GN=xlnR PE=3 SV=2 44 112 9.0E-08
sp|P25502|PUT3_YEAST Proline utilization trans-activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT3 PE=1 SV=1 303 470 1.0E-07
sp|B0XUL1|XLNR_ASPFC Xylanolytic transcriptional activator xlnR OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnR PE=3 SV=1 37 112 1.0E-07
sp|Q2UD93|XLNR_ASPOR Xylanolytic transcriptional activator xlnR OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnR PE=1 SV=2 61 112 2.0E-07
sp|Q4WZV6|XLNR_ASPFU Xylanolytic transcriptional activator xlnR OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnR PE=3 SV=1 37 112 2.0E-07
sp|B8N6M6|XLNR_ASPFN Xylanolytic transcriptional activator xlnR OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnR PE=3 SV=1 61 112 2.0E-07
sp|Q4WK35|AMDR_ASPFU Acetamidase regulatory protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=amdR PE=3 SV=1 320 649 2.0E-07
sp|Q5AVS0|XLNR_EMENI Xylanolytic transcriptional activator xlnR OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnR PE=2 SV=2 70 112 3.0E-07
sp|A1C7P9|XLNR_ASPCL Xylanolytic transcriptional activator xlnR OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnR PE=3 SV=2 44 112 4.0E-07
sp|G4MZJ4|XLNR_MAGO7 Xylanolytic transcriptional activator xlnR homolog OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=xlr1 PE=3 SV=1 70 112 4.0E-07
sp|Q4I0C5|RDR1_GIBZE Protein RDR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RDR1 PE=3 SV=1 68 122 6.0E-07
sp|O74541|YCV2_SCHPO Uncharacterized transcriptional regulatory protein C777.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.02 PE=3 SV=4 76 136 1.0E-06
sp|P38157|MAL33_YEAST Maltose fermentation regulatory protein MAL33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL33 PE=3 SV=1 73 112 2.0E-06
sp|P39961|YE14_YEAST Uncharacterized transcriptional regulatory protein YER184C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER184C PE=3 SV=1 68 136 2.0E-06
sp|Q59NX5|FGR27_CANAL Filamentous growth regulator 27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FGR27 PE=2 SV=1 52 105 4.0E-06
sp|Q9P6I9|YHDD_SCHPO Uncharacterized transcriptional regulatory protein C1683.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.13c PE=1 SV=1 68 136 5.0E-06
sp|P53338|MAL13_YEAST Maltose fermentation regulatory protein MAL13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL13 PE=3 SV=1 67 124 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0046872 metal ion binding No
GO:0046483 heterocycle metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0140110 transcription regulator activity No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003700 DNA-binding transcription factor activity No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0046914 transition metal ion binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0097159 organic cyclic compound binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0050789 regulation of biological process No
GO:0016070 RNA metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009889 regulation of biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1012
MPSLLAQPGLPLCLGVSVLSMSGDLSDDDAVGDWQLHHASSPADSAKSDAELDDKAASDPSAPSQPIQKRRRVTR
ACDECRRKKIKCDGKQPCTHCSVYSYECTYDKPSNRRRNPAPQYIEALENRLQRAEALLRKYMPDVDLADPNLDP
TIQQEFLNRQRARAKQHHSSADDPTSHSDAKLMTMIDSIGQLDLDDKGEWDFHGTSSGAVFLRRMKDHLRGMLGP
PTKAPFLPRPERPPGLMALGSPSPRGGSPLSTASAIAELPGPSKDAARKLCYYSLSCATCLVRIVHVPSFYERFE
RVYDRPVDSLDQEDTRFLGLIYAVLALGCMYSNLDDAKPESGAYKAAIDQGFKYYKMARGLLQDLAECRDIPSLQ
ALLYMILFLQATSNLSACYSFIGVALRSALRIGLHRHLQHDKIGVVEQQVRRRVFYVIRQLDIYVSTMLGFPLLL
NLDDVDQAYPVEVDDEYVLETGIMSPPAGTPSFFEAFNAQTRLMEVLGKITKYVYPMQGQDQPTAKGAPTYLISY
ARIKEIETELQTWYERLPEMWRPSPEGPIEVVRVRHLLRFAYAHVQLVLYRPFLHYISPRLSQASEVDELSYACA
AAAISVSRNIVHIGLEIRKQGVLSGPYWFMLYTEFFAVLSLVFYALENPDKPGSQEVLADAWAGRRMIADLADKS
MSADRVTNALKPLFDQLPESLDQARTRPLPSKKRSAVPGKTESCVSPHALASPGPSTQRIGDFARAGASTLQKAP
LASPASQVSVDSSGQSMEHVIPGLSFAAGMQDVIPMDLSSRATPELSGSGSSQRQRLWSQQPQQGTPNSVNKLDS
LMFPSDDPFAYPNQLMMELGFQPKADGTSAAMPTSGHDAPAFFTTSLDELGDDMLGHNQSYMMQQQQQQQQLHHQ
QQLLFGLTGNLYDPHDMMAMHTAQHQQQQQQQQQQQQQQHQYQQQQQQQQQQQERQYQQQQVPRSSAPPQGHRSI
FSSFRRTRSDRQQARQIEQLFTQQGMQPDWGSFFGSGRGGFQGM
Coding >Ophio5|1012
ATGCCCTCTTTGCTTGCCCAGCCCGGCCTCCCACTGTGCCTTGGAGTCTCTGTTCTCAGCATGTCTGGCGACCTG
TCCGACGATGACGCCGTCGGCGACTGGCAGCTGCACCATGCTTCATCGCCCGCCGATAGCGCTAAATCCGACGCC
GAGCTCGACGACAAGGCTGCTTCGGATCCCTCTGCGCCCTCACAGCCCATTCAGAAGCGCCGCCGAGTCACGCGC
GCATGCGACGAGTGTCGCCGCAAGAAGATCAAGTGTGATGGCAAGCAGCCCTGCACCCATTGCTCCGTCTATAGC
TATGAATGTACATACGACAAGCCCTCCAACAGAAGGAGAAATCCGGCTCCTCAGTACATCGAAGCCCTCGAGAAC
CGTCTGCAGCGCGCAGAGGCGCTCCTCCGCAAGTATATGCCCGATGTCGACTTGGCCGACCCCAACCTCGACCCT
ACCATCCAGCAGGAATTTCTCAACCGTCAAAGGGCTCGCGCGAAGCAGCATCATAGCTCGGCCGACGATCCGACA
AGCCACAGCGACGCCAAGCTGATGACCATGATTGACTCCATCGGCCAGCTTGATCTCGATGACAAGGGCGAATGG
GACTTTCACGGCACCTCGTCCGGCGCCGTCTTCCTGAGGCGGATGAAGGATCATCTCCGCGGTATGCTTGGTCCT
CCGACCAAGGCTCCGTTTCTGCCCCGCCCTGAGCGTCCCCCGGGCCTGATGGCTTTGGGATCGCCGTCTCCCCGC
GGAGGCTCCCCTCTCTCGACCGCGTCTGCCATAGCCGAACTGCCCGGGCCTTCCAAGGATGCCGCCCGCAAGCTG
TGCTACTACTCGCTGAGCTGCGCCACGTGCCTCGTCCGCATCGTTCACGTACCCTCCTTTTACGAGAGATTCGAA
CGAGTCTATGACCGTCCAGTTGACAGCCTCGATCAAGAGGACACACGCTTCTTGGGACTCATCTATGCCGTCCTC
GCCCTCGGCTGCATGTACAGCAACCTGGACGACGCCAAGCCCGAGAGCGGAGCCTACAAGGCGGCCATTGACCAA
GGCTTCAAGTATTACAAGATGGCGAGGGGGCTTCTGCAGGATCTGGCCGAGTGCCGTGACATCCCCTCGCTCCAG
GCTTTGTTGTACATGATCCTCTTTCTCCAAGCCACGTCGAACCTCAGTGCCTGCTACTCCTTCATCGGCGTCGCG
CTGCGGTCGGCACTGCGCATCGGCCTCCACCGACATCTGCAGCATGACAAGATTGGCGTTGTCGAGCAACAGGTG
CGGAGGCGGGTCTTTTACGTGATTCGGCAGCTGGACATTTACGTCTCGACCATGCTCGGCTTCCCACTCCTCCTC
AACCTCGACGATGTCGATCAGGCGTACCCGGTCGAGGTCGACGACGAGTACGTCTTGGAAACGGGCATCATGTCA
CCGCCCGCCGGGACGCCGTCCTTCTTCGAAGCCTTCAACGCGCAGACTCGACTGATGGAGGTGCTCGGCAAGATT
ACCAAATACGTGTACCCGATGCAGGGACAGGACCAGCCCACCGCCAAGGGTGCCCCGACCTATCTCATCAGCTAC
GCCCGCATCAAGGAGATCGAGACGGAGCTGCAGACATGGTACGAGAGGCTACCGGAGATGTGGCGGCCGAGCCCG
GAGGGACCAATCGAGGTAGTGCGGGTGCGGCACTTGCTTCGGTTTGCATACGCACATGTGCAGCTCGTCCTTTAC
CGGCCCTTTTTGCATTACATATCTCCCCGTCTCAGCCAGGCTAGCGAAGTGGACGAACTATCGTATGCCTGCGCC
GCCGCGGCCATCAGCGTGTCACGAAACATTGTCCACATAGGTCTGGAGATCCGCAAGCAGGGCGTCCTCAGCGGG
CCGTACTGGTTCATGCTCTACACCGAATTCTTTGCCGTTCTCTCTCTCGTCTTCTACGCGCTCGAAAACCCGGAC
AAGCCAGGGTCGCAGGAAGTGCTGGCCGATGCTTGGGCTGGGAGGCGGATGATTGCCGACCTGGCCGACAAGAGC
ATGTCCGCCGACCGGGTGACGAACGCTCTCAAGCCCCTGTTCGATCAACTACCCGAGAGCCTCGACCAGGCTCGC
ACACGGCCGCTGCCCTCGAAGAAGAGGTCCGCTGTCCCGGGCAAGACCGAGTCGTGCGTATCGCCCCACGCCCTT
GCGAGCCCCGGCCCGTCGACGCAGCGGATCGGCGACTTTGCACGCGCTGGCGCCTCGACGCTGCAAAAGGCCCCC
CTCGCCTCGCCGGCGTCGCAGGTCTCGGTCGACAGCTCAGGGCAGTCGATGGAGCATGTCATACCGGGACTGTCG
TTTGCAGCAGGCATGCAGGACGTGATCCCGATGGATCTGTCTTCACGGGCGACGCCCGAATTGTCCGGCTCGGGG
AGCTCCCAGCGGCAACGGCTCTGGTCTCAACAACCCCAGCAGGGCACGCCCAACTCCGTGAACAAGCTGGATTCG
CTCATGTTCCCATCCGACGATCCGTTTGCGTACCCCAACCAGCTGATGATGGAGCTCGGCTTCCAGCCTAAGGCG
GACGGGACGTCGGCAGCAATGCCAACCTCGGGCCACGACGCTCCCGCCTTCTTTACGACGTCGCTGGACGAGTTG
GGCGATGATATGCTGGGCCACAATCAGTCCTACATGATGCAGCAGCAGCAGCAGCAGCAGCAGCTCCATCACCAG
CAGCAGCTGCTGTTTGGTCTCACGGGAAATCTTTACGACCCCCACGATATGATGGCAATGCACACGGCACAGCAT
CAACAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCATCAATACCAGCAGCAGCAACAACAGCAGCAG
CAGCAGCAGGAACGACAGTATCAGCAGCAGCAAGTCCCACGAAGCTCGGCGCCGCCGCAAGGCCATCGGAGCATC
TTCTCGAGCTTCCGGCGAACGCGTTCGGATCGGCAGCAAGCCAGGCAAATCGAGCAGCTGTTTACGCAGCAGGGA
ATGCAGCCCGACTGGGGGAGTTTCTTTGGTTCTGGAAGAGGAGGATTTCAAGGAATG
Transcript >Ophio5|1012
ATGCCCTCTTTGCTTGCCCAGCCCGGCCTCCCACTGTGCCTTGGAGTCTCTGTTCTCAGCATGTCTGGCGACCTG
TCCGACGATGACGCCGTCGGCGACTGGCAGCTGCACCATGCTTCATCGCCCGCCGATAGCGCTAAATCCGACGCC
GAGCTCGACGACAAGGCTGCTTCGGATCCCTCTGCGCCCTCACAGCCCATTCAGAAGCGCCGCCGAGTCACGCGC
GCATGCGACGAGTGTCGCCGCAAGAAGATCAAGTGTGATGGCAAGCAGCCCTGCACCCATTGCTCCGTCTATAGC
TATGAATGTACATACGACAAGCCCTCCAACAGAAGGAGAAATCCGGCTCCTCAGTACATCGAAGCCCTCGAGAAC
CGTCTGCAGCGCGCAGAGGCGCTCCTCCGCAAGTATATGCCCGATGTCGACTTGGCCGACCCCAACCTCGACCCT
ACCATCCAGCAGGAATTTCTCAACCGTCAAAGGGCTCGCGCGAAGCAGCATCATAGCTCGGCCGACGATCCGACA
AGCCACAGCGACGCCAAGCTGATGACCATGATTGACTCCATCGGCCAGCTTGATCTCGATGACAAGGGCGAATGG
GACTTTCACGGCACCTCGTCCGGCGCCGTCTTCCTGAGGCGGATGAAGGATCATCTCCGCGGTATGCTTGGTCCT
CCGACCAAGGCTCCGTTTCTGCCCCGCCCTGAGCGTCCCCCGGGCCTGATGGCTTTGGGATCGCCGTCTCCCCGC
GGAGGCTCCCCTCTCTCGACCGCGTCTGCCATAGCCGAACTGCCCGGGCCTTCCAAGGATGCCGCCCGCAAGCTG
TGCTACTACTCGCTGAGCTGCGCCACGTGCCTCGTCCGCATCGTTCACGTACCCTCCTTTTACGAGAGATTCGAA
CGAGTCTATGACCGTCCAGTTGACAGCCTCGATCAAGAGGACACACGCTTCTTGGGACTCATCTATGCCGTCCTC
GCCCTCGGCTGCATGTACAGCAACCTGGACGACGCCAAGCCCGAGAGCGGAGCCTACAAGGCGGCCATTGACCAA
GGCTTCAAGTATTACAAGATGGCGAGGGGGCTTCTGCAGGATCTGGCCGAGTGCCGTGACATCCCCTCGCTCCAG
GCTTTGTTGTACATGATCCTCTTTCTCCAAGCCACGTCGAACCTCAGTGCCTGCTACTCCTTCATCGGCGTCGCG
CTGCGGTCGGCACTGCGCATCGGCCTCCACCGACATCTGCAGCATGACAAGATTGGCGTTGTCGAGCAACAGGTG
CGGAGGCGGGTCTTTTACGTGATTCGGCAGCTGGACATTTACGTCTCGACCATGCTCGGCTTCCCACTCCTCCTC
AACCTCGACGATGTCGATCAGGCGTACCCGGTCGAGGTCGACGACGAGTACGTCTTGGAAACGGGCATCATGTCA
CCGCCCGCCGGGACGCCGTCCTTCTTCGAAGCCTTCAACGCGCAGACTCGACTGATGGAGGTGCTCGGCAAGATT
ACCAAATACGTGTACCCGATGCAGGGACAGGACCAGCCCACCGCCAAGGGTGCCCCGACCTATCTCATCAGCTAC
GCCCGCATCAAGGAGATCGAGACGGAGCTGCAGACATGGTACGAGAGGCTACCGGAGATGTGGCGGCCGAGCCCG
GAGGGACCAATCGAGGTAGTGCGGGTGCGGCACTTGCTTCGGTTTGCATACGCACATGTGCAGCTCGTCCTTTAC
CGGCCCTTTTTGCATTACATATCTCCCCGTCTCAGCCAGGCTAGCGAAGTGGACGAACTATCGTATGCCTGCGCC
GCCGCGGCCATCAGCGTGTCACGAAACATTGTCCACATAGGTCTGGAGATCCGCAAGCAGGGCGTCCTCAGCGGG
CCGTACTGGTTCATGCTCTACACCGAATTCTTTGCCGTTCTCTCTCTCGTCTTCTACGCGCTCGAAAACCCGGAC
AAGCCAGGGTCGCAGGAAGTGCTGGCCGATGCTTGGGCTGGGAGGCGGATGATTGCCGACCTGGCCGACAAGAGC
ATGTCCGCCGACCGGGTGACGAACGCTCTCAAGCCCCTGTTCGATCAACTACCCGAGAGCCTCGACCAGGCTCGC
ACACGGCCGCTGCCCTCGAAGAAGAGGTCCGCTGTCCCGGGCAAGACCGAGTCGTGCGTATCGCCCCACGCCCTT
GCGAGCCCCGGCCCGTCGACGCAGCGGATCGGCGACTTTGCACGCGCTGGCGCCTCGACGCTGCAAAAGGCCCCC
CTCGCCTCGCCGGCGTCGCAGGTCTCGGTCGACAGCTCAGGGCAGTCGATGGAGCATGTCATACCGGGACTGTCG
TTTGCAGCAGGCATGCAGGACGTGATCCCGATGGATCTGTCTTCACGGGCGACGCCCGAATTGTCCGGCTCGGGG
AGCTCCCAGCGGCAACGGCTCTGGTCTCAACAACCCCAGCAGGGCACGCCCAACTCCGTGAACAAGCTGGATTCG
CTCATGTTCCCATCCGACGATCCGTTTGCGTACCCCAACCAGCTGATGATGGAGCTCGGCTTCCAGCCTAAGGCG
GACGGGACGTCGGCAGCAATGCCAACCTCGGGCCACGACGCTCCCGCCTTCTTTACGACGTCGCTGGACGAGTTG
GGCGATGATATGCTGGGCCACAATCAGTCCTACATGATGCAGCAGCAGCAGCAGCAGCAGCAGCTCCATCACCAG
CAGCAGCTGCTGTTTGGTCTCACGGGAAATCTTTACGACCCCCACGATATGATGGCAATGCACACGGCACAGCAT
CAACAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCATCAATACCAGCAGCAGCAACAACAGCAGCAG
CAGCAGCAGGAACGACAGTATCAGCAGCAGCAAGTCCCACGAAGCTCGGCGCCGCCGCAAGGCCATCGGAGCATC
TTCTCGAGCTTCCGGCGAACGCGTTCGGATCGGCAGCAAGCCAGGCAAATCGAGCAGCTGTTTACGCAGCAGGGA
ATGCAGCCCGACTGGGGGAGTTTCTTTGGTTCTGGAAGAGGAGGATTTCAAGGAATGTAA
Gene >Ophio5|1012
ATGCCCTCTTTGCTTGCCCAGCCCGGGTCCTGCAGTCCACCACGCCGCTCGCCTCGGCGCTTGACCAACGGCCTC
GGCGCTGGCCCTGCTTGACGCTTTGAAAAGCCTCCCACTGTGCCTTGGAGTCTCTGTGTAAGCCTCGTCTTCTGC
TGTTCTTGTCTTCCTGTCGAGATAAAGAAAGATTAGAAAATGTTGAGGAAAGGGGAGAGAAAAGAGAGAAATCCT
GATATCATCATCCCATCTCCGTTCGTCTCACCGTTCCTCGGCACCAATCTGACAGACTCTCCCAGTCTCAGCATG
TCTGGCGACCTGTCCGACGATGACGCCGTCGGCGACTGGCAGCTGCACCATGCTTCATCGCCCGCCGATAGCGCT
AAATCCGACGCCGAGCTCGACGACAAGGCTGCTTCGGATCCCTCTGCGCCCTCACAGCCCATTCAGAAGCGCCGC
CGAGTCACGCGCGCATGCGACGAGTGTCGCCGCAAGAAGATCAAGTGTGATGGCAAGCAGCCCTGCACCCATTGC
TCCGTCTATAGCTATGGTGTGCCGGCCCACTCGTCCATGTCCTCTCGTCCGAATACTCACTGCCGGTCCAGAATG
TACATACGACAAGCCCTCCAACAGAAGGAGAAATCCGGCTCCTCAGTACATCGAAGCCCTCGAGAACCGTCTGCA
GCGCGCAGAGGCGCTCCTCCGCAAGTATATGCCCGATGTCGACTTGGCCGACCCCAACCTCGACCCTACCATCCA
GCAGGAATTTCTCAACCGTCAAAGGGCTCGCGCGAAGCAGCATCATAGCTCGGCCGACGATCCGACAAGCCACAG
CGACGCCAAGCTGATGACCATGATTGACTCCATCGGCCAGCTTGATCTCGATGACAAGGGCGAATGGGACTTTCA
CGGCACCTCGTCCGGCGCCGTCTTCCTGAGGCGGATGAAGGATCATCTCCGCGGTATGCTTGGTCCTCCGACCAA
GGCTCCGTTTCTGCCCCGCCCTGAGCGTCCCCCGGGCCTGATGGCTTTGGGATCGCCGTCTCCCCGCGGAGGCTC
CCCTCTCTCGACCGCGTCTGCCATAGCCGAACTGCCCGGGCCTTCCAAGGATGCCGCCCGCAAGCTGTGCTACTA
CTCGCTGAGCTGCGCCACGTGCCTCGTCCGCATCGTTCACGTACCCTCCTTTTACGAGAGATTCGAACGAGTCTA
TGACCGTCCAGTTGACAGCCTCGATCAAGAGGACACACGCTTCTTGGGACTCATCTATGCCGTCCTCGCCCTCGG
CTGCATGTACAGCAACCTGGACGACGCCAAGCCCGAGAGCGGAGCCTACAAGGCGGCCATTGACCAAGGGTGTGT
TTGCTTCCCTCTCCGTCTTTTCCCTCAGCTGACCAGATGCCCTCTTGCGCAGCTTCAAGTATTACAAGATGGCGA
GGGGGCTTCTGCAGGATCTGGCCGAGTGCCGTGACATCCCCTCGCTCCAGGCTTTGTTGTACATGATCCTCTTTC
TCCAAGCCACGTCGAACCTCAGTGCCTGCTACTCCTTCATCGGCGTCGCGCTGCGGTCGGCACTGCGCATCGGCC
TCCACCGACATCTGCAGCATGACAAGATTGGCGTTGTCGAGCAACAGGTGCGGAGGCGGGTCTTTTACGTGATTC
GGCAGCTGGACATTTACGTCTCGACCATGCTCGGCTTCCCACTCCTCCTCAACCTCGACGATGTCGATCAGGCGT
ACCCGGTCGAGGTCGACGACGAGTACGTCTTGGAAACGGGCATCATGTCACCGCCCGCCGGGACGCCGTCCTTCT
TCGAAGCCTTCAACGCGCAGACTCGACTGATGGAGGTGCTCGGCAAGATTACCAAATACGTGTACCCGATGCAGG
GACAGGACCAGCCCACCGCCAAGGGTGCCCCGACCTATCTCATCAGCTACGCCCGCATCAAGGAGATCGAGACGG
AGCTGCAGACATGGTACGAGAGGCTACCGGAGATGTGGCGGCCGAGCCCGGAGGGACCAATCGAGGTAGTGCGGT
GAGTTCATGGCCATTGGCTTTCCGGGTCGCGCCGTGGATGCTCAACTGACTCGGACGTCAGGGTGCGGCACTTGC
TTCGGTTTGCATACGCACATGTGCAGCTCGTCCTTTACCGGCCCTTTTTGCATTACATATCTCCCCGTCTCAGCC
AGGCTAGCGAAGTGGACGAACTATCGTATGCCTGCGCCGCCGCGGCCATCAGCGTGTCACGAAACATTGTCCACA
TAGGTCTGGAGATCCGCAAGCAGGGCGTCCTCAGCGGGCCGTACTGGTTCATGCTCTACACCGAATTCTTTGCCG
TTCTCTCTCTCGTCTTCTACGCGCTCGAAAACCCGGACAAGCCAGGGTCGCAGGAAGTGCTGGCCGATGCTTGGG
CTGGGAGGCGGATGATTGCCGACCTGGCCGACAAGAGCATGTCCGCCGACCGGGTGACGAACGCTCTCAAGGTAC
GCTTCAAGAGCTCAACAAGTCTTGAAAATCTTAATGACCCAAAATGACCAGCCCCTGTTCGATCAACTACCCGAG
AGCCTCGACCAGGCTCGCACACGGCCGCTGCCCTCGAAGAAGAGGTCCGCTGTCCCGGGCAAGACCGAGTCGTGC
GTATCGCCCCACGCCCTTGCGAGCCCCGGCCCGTCGACGCAGCGGATCGGCGACTTTGCACGCGCTGGCGCCTCG
ACGCTGCAAAAGGCCCCCCTCGCCTCGCCGGCGTCGCAGGTCTCGGTCGACAGCTCAGGGCAGTCGATGGAGCAT
GTCATACCGGGACTGTCGTTTGCAGCAGGCATGCAGGACGTGATCCCGATGGATCTGTCTTCACGGGCGACGCCC
GAATTGTCCGGCTCGGGGAGCTCCCAGCGGCAACGGCTCTGGTCTCAACAACCCCAGCAGGGCACGCCCAACTCC
GTGAACAAGCTGGATTCGCTCATGTTCCCATCCGACGATCCGTTTGCGTACCCCAACCAGCTGATGATGGAGCTC
GGCTTCCAGCCTAAGGCGGACGGGACGTCGGCAGCAATGCCAACCTCGGGCCACGACGCTCCCGCCTTCTTTACG
ACGTCGCTGGACGAGTTGGGCGATGATATGCTGGGCCACAATCAGTCCTACATGATGCAGCAGCAGCAGCAGCAG
CAGCAGCTCCATCACCAGCAGCAGCTGCTGTTTGGTCTCACGGGAAATCTTTACGACCCCCACGATATGATGGCA
ATGCACACGGCACAGCATCAACAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCATCAATACCAGCAG
CAGCAACAACAGCAGCAGCAGCAGCAGGAACGACAGTATCAGCAGCAGCAAGTCCCACGAAGCTCGGCGCCGCCG
CAAGGCCATCGGAGCATCTTCTCGAGCTTCCGGCGAACGCGTTCGGATCGGCAGCAAGCCAGGCAAATCGAGCAG
CTGTTTACGCAGCAGGGAATGCAGCCCGACTGGGGGAGTTTCTTTGGTTCTGGAAGAGGAGGATTTCAAGGAATG
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail