Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07444
Gene name
Locationscaffold_12:9788..11142
Strand+
Gene length (bp)1354
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.11 0.0 0.38
Alive In ants, during behavior modification 0.02 0.0 0.15
Dead In ants, recently dead 0.08 0.0 0.28

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 1.0 no
Alive Dead 1.0 no
Dead Fungus 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07444
MQHEEEVDHKSGGLPPQYEDMDFGESRTTKTAAWWKPRYWRKRTWAIVAGVFIVIIAVVVAVAVALSGLTNYPDY
KAVSYALRDTYEGENFFDQFNYFTGWDPTKGFVHYVPRPQAQQLNLTYASTNTAIVRVDTSVGPGSRPDASTGRF
SVRLESKKTPRRDRHHGVDQQRAGGNQMSLHTADGCSMAVTRKMKGHALHNDCNQASNGNAGCGVTGGRNSFGPA
LNAAGGSVMAVEWREAGIRVWQFGRGDVPSDVVAKRPNPAGWGTATADFPNTRCGIGSMFRNNSIVIDIDLCGDM
VYGTWDRSSCPSTCTDLVSNQPALFKTAYWEFGSFQVYQPASPS*
Coding >Ophcf2|07444
ATGCAGCACGAAGAAGAAGTCGATCACAAGTCGGGGGGTCTTCCCCCCCAATACGAGGACATGGACTTTGGCGAG
TCACGGACGACGAAGACGGCGGCTTGGTGGAAGCCGCGGTACTGGCGGAAGCGAACCTGGGCTATTGTCGCGGGC
GTCTTCATCGTCATCATTGCCGTCGTTGTGGCTGTTGCCGTTGCCTTGTCTGGCTTGACGAATTATCCGGATTAT
AAGGCTGTGTCGTACGCTTTGCGAGATACCTATGAGGGGGAAAACTTCTTTGATCAGTTCAATTACTTTACCGGC
TGGGATCCCACCAAGGGCTTCGTTCATTATGTTCCACGACCGCAGGCTCAACAGCTGAACCTAACGTACGCGTCA
ACCAACACAGCCATCGTGAGAGTCGACACCTCAGTCGGTCCCGGATCCAGACCCGATGCCTCAACAGGCCGCTTC
TCCGTAAGACTCGAGTCAAAGAAGACACCACGGAGAGATCGACATCATGGAGTCGATCAACAACGCGCAGGCGGG
AACCAGATGTCGCTGCATACGGCGGATGGGTGTTCCATGGCCGTGACGCGCAAGATGAAGGGCCACGCGCTGCAC
AATGACTGCAATCAGGCTAGTAACGGCAACGCCGGCTGTGGCGTCACCGGCGGGCGCAACTCGTTTGGTCCTGCT
CTGAACGCTGCTGGCGGGAGCGTCATGGCGGTTGAGTGGCGAGAAGCCGGCATTCGGGTTTGGCAGTTTGGTCGT
GGAGATGTGCCGTCTGATGTTGTGGCCAAGAGGCCTAACCCTGCTGGTTGGGGCACTGCCACGGCTGATTTTCCG
AATACTCGCTGTGGCATTGGCTCGATGTTCCGGAACAACTCCATCGTCATCGATATCGATCTGTGCGGTGATATG
GTATATGGCACCTGGGATCGTTCGTCGTGCCCGAGCACCTGCACTGATCTCGTGTCCAACCAGCCCGCCCTCTTC
AAGACGGCGTACTGGGAGTTTGGCTCCTTTCAAGTCTACCAACCGGCGTCTCCGTCGTGA
Transcript >Ophcf2|07444
ATGCAGCACGAAGAAGAAGTCGATCACAAGTCGGGGGGTCTTCCCCCCCAATACGAGGACATGGACTTTGGCGAG
TCACGGACGACGAAGACGGCGGCTTGGTGGAAGCCGCGGTACTGGCGGAAGCGAACCTGGGCTATTGTCGCGGGC
GTCTTCATCGTCATCATTGCCGTCGTTGTGGCTGTTGCCGTTGCCTTGTCTGGCTTGACGAATTATCCGGATTAT
AAGGCTGTGTCGTACGCTTTGCGAGATACCTATGAGGGGGAAAACTTCTTTGATCAGTTCAATTACTTTACCGGC
TGGGATCCCACCAAGGGCTTCGTTCATTATGTTCCACGACCGCAGGCTCAACAGCTGAACCTAACGTACGCGTCA
ACCAACACAGCCATCGTGAGAGTCGACACCTCAGTCGGTCCCGGATCCAGACCCGATGCCTCAACAGGCCGCTTC
TCCGTAAGACTCGAGTCAAAGAAGACACCACGGAGAGATCGACATCATGGAGTCGATCAACAACGCGCAGGCGGG
AACCAGATGTCGCTGCATACGGCGGATGGGTGTTCCATGGCCGTGACGCGCAAGATGAAGGGCCACGCGCTGCAC
AATGACTGCAATCAGGCTAGTAACGGCAACGCCGGCTGTGGCGTCACCGGCGGGCGCAACTCGTTTGGTCCTGCT
CTGAACGCTGCTGGCGGGAGCGTCATGGCGGTTGAGTGGCGAGAAGCCGGCATTCGGGTTTGGCAGTTTGGTCGT
GGAGATGTGCCGTCTGATGTTGTGGCCAAGAGGCCTAACCCTGCTGGTTGGGGCACTGCCACGGCTGATTTTCCG
AATACTCGCTGTGGCATTGGCTCGATGTTCCGGAACAACTCCATCGTCATCGATATCGATCTGTGCGGTGATATG
GTATATGGCACCTGGGATCGTTCGTCGTGCCCGAGCACCTGCACTGATCTCGTGTCCAACCAGCCCGCCCTCTTC
AAGACGGCGTACTGGGAGTTTGGCTCCTTTCAAGTCTACCAACCGGCGTCTCCGTCGTGA
Gene >Ophcf2|07444
ATGCAGCACGAAGAAGAAGTCGATCACAAGTCGGGGGGTCTTCCCCCCCAATACGAGGACATGGACTTTGGCGAG
TCACGGACGACGAAGACGGCGGCTTGGTGGAAGCCGCGGTACTGGCGGAAGCGAACCTGGGCTATTGTCGCGGGC
GTCTTCATCGTCATCATTGCCGTCGTTGTGGCTGTTGCCGTTGCCTTGTCTGGCTTGACGAATTATCCGGATTAT
AAGGCTGTGTCGTACGCTTTGCGAGATACCTGTGAGTTGGTGGTGGTTTGCTTGCTTGGATGGCGACTCTGACAT
TCATCTGATTTAGATGAGGGGGAAAACTTCTTTGATCAGTTCAATTACTTTACCGGCTGGGATCCCAGTTAGTTT
CCCCATGGTTGTCTTGAGGTTTCCTGGGCTGACGAGGAGGTGCCATTCAGCCAAGGGCTTCGTTCATTATGTTCC
ACGACCGCAGGCTCAACAGCTGGTAAGAGACCAGAGATGAAAAGACGCCATGAGAAAAGCTGACGGTCCGATGTA
GAACCTAACGTACGCGTCAACCAACACAGCCATCGTGAGAGTCGACACCTCAGTCGGTCCCGGATCCAGACCCGA
TGCCTCAACAGGCCGCTTCTCCGTAAGACTCGAGTCAAAGAAGACGTACGGAGGCGGCCTCTTCGTCTTCGACGT
CAAGCACACGCCTCACGCTTGCGGCACCTGGCCAGCCCTCTGGCTAACGGACCCATCCACTGGCCAGACCACGGA
GAGATCGACATCATGGAGTCGATCAACAACGCGCAGGCGGGAACCAGATGTCGCTGCATACGGCGGATGGGTGTT
CCATGGCCGTGACGCGCAAGATGAAGGGCCACGCGCTGCACAATGACTGCAATCAGGCTAGTAACGGCAACGCCG
GCTGTGGCGTCACCGGCGGGCGCAACTCGTTTGGTCCTGCTCTGAACGCTGCTGGCGGGAGCGTCATGGCGGTTG
AGTGGCGAGAAGCCGGCATTCGGGTTTGGCAGTTTGGTCGTGGAGATGTGCCGTCTGATGTTGTGGCCAAGAGGC
CTAACCCTGCTGGTTGGGGCACTGCCACGGCTGATTTTCCGAATACTCGCTGTGGCATTGGCTCGATGTTCCGGA
ACAACTCCATCGTCATCGATATCGATCTGTGCGGTGATATGGTATATGGCACCTGGGATCGTTCGTCGTGTGAGT
CGTCATCTTTTTCCGTCGTCATTCTTCTGAGCTGACCCTGGAGTCAGGCCCGAGCACCTGCACTGATCTCGTGTC
CAACCAGCCCGCCCTCTTCAAGACGGCGTACTGGGAGTTTGGCTCCTTTCAAGTCTACCAACCGGCGTCTCCGTC
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail