Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07443
Gene name
Locationscaffold_12:5865..9089
Strand+
Gene length (bp)3224
Transcript length (bp)1854
Coding sequence length (bp)1854
Protein length (aa) 618

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02731 SKIP_SNW SKIP/SNW domain 1.4E-64 270 427
PF01105 EMP24_GP25L emp24/gp25L/p24 family/GOLD 4.6E-47 22 204

GO

GO Term Description Terminal node
GO:0005681 spliceosomal complex Yes
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:0006397 mRNA processing No
GO:0044237 cellular metabolic process No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:1901360 organic cyclic compound metabolic process No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:1990904 ribonucleoprotein complex No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0008380 RNA splicing No
GO:0090304 nucleic acid metabolic process No
GO:0016071 mRNA metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 177 199 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.36 0.0 0.78
Alive In ants, during behavior modification 0.53 0.0 1.09
Dead In ants, recently dead 0.36 0.0 0.79

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 1.0 no
Alive Dead 1.0 no
Dead Fungus 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07443
MRLPTIAAGVFACLVTNVVATALTYKLEAGEKACFYAETNKENEKIAFYFAVQSGGSFDIDYRVEGPDSKIILEG
EKERQGDFVFSAQKTGEYSFCFDNEMSTFTEKMIDIEISSEHEARTAQLPSKQGTSPEQTSVLEESIFKISGQLS
TISRNQKYFRTRENRNFSTVNSTEKRIVNFSVIQICLIVCMGALQVLVVRFFFQGARKGYDLIPLRQRADAGEID
LARPDKETVAATTEKTKNALTALISGAVAAQKPKNINVGQRKEATFVRYTPANQMGDNSKKQDRIIKIVERQRDP
MEPPKFKHKKIPRGPPSPPPPVMRSPPRKLTAEDQEMWRIPPPVSNWKNPKGFTVPLDKRLAADGRGLHDVTIND
KHAQFAEAVKMAERHAREVQQRALMQQRLAEQEKARKDDSLRALALKTREERLAQSSTPRASEESDSEDAEIRER
ERPDASGARKKSANCGRTEWAQSGGSRGFDSGFNEDNHYDKPLFAAQDAISSIYRPRANVNDDSFDDDAGDKEMA
KIHKISRFGEALGKGPFEARPMPRQTVGTRRTRSVRKEAADPFNVDKFLSEVDQSTSSKRGYGLQADGGGGGRQA
KRARVDDDDDEGGGGGE*
Coding >Ophcf2|07443
ATGAGACTGCCAACCATCGCAGCGGGCGTCTTTGCCTGTTTAGTCACCAATGTCGTCGCCACGGCGCTGACGTAC
AAGCTGGAAGCGGGCGAGAAGGCCTGCTTCTACGCCGAGACCAACAAGGAGAACGAGAAGATTGCGTTTTATTTT
GCCGTCCAATCTGGAGGCTCTTTCGATATCGACTACCGTGTTGAGGGCCCGGACTCGAAGATTATCCTCGAGGGC
GAGAAGGAGCGTCAAGGCGACTTCGTCTTCTCGGCTCAAAAGACGGGCGAATACTCTTTTTGTTTCGACAACGAG
ATGAGCACCTTTACGGAGAAGATGATCGATATCGAGATCTCAAGCGAGCACGAAGCCCGCACAGCCCAGCTTCCA
TCCAAGCAGGGAACATCTCCCGAGCAAACGTCGGTCCTGGAGGAGTCGATATTCAAGATCTCAGGTCAACTATCT
ACCATCTCGCGCAACCAGAAATACTTTCGAACTCGGGAAAACCGCAACTTTAGCACCGTCAACAGCACAGAGAAA
CGGATTGTCAACTTTAGCGTGATTCAGATTTGCCTTATCGTCTGCATGGGCGCCCTTCAGGTGTTGGTCGTCAGG
TTCTTCTTCCAGGGAGCACGCAAAGGCTATGATCTCATTCCGTTGCGGCAGCGGGCTGACGCTGGCGAGATCGAT
CTCGCCCGGCCAGACAAGGAGACGGTGGCGGCGACGACAGAAAAGACCAAGAACGCCTTGACCGCACTCATCAGC
GGCGCCGTGGCAGCGCAGAAGCCAAAGAATATCAACGTCGGACAGCGAAAGGAAGCCACCTTTGTGCGCTACACG
CCGGCCAACCAAATGGGCGATAATTCCAAGAAGCAGGACCGCATCATCAAGATTGTCGAGCGACAACGCGATCCC
ATGGAGCCGCCCAAGTTCAAGCACAAGAAGATCCCCCGCGGTCCTCCTTCACCGCCGCCGCCTGTGATGCGCTCG
CCGCCCCGGAAGCTTACAGCCGAGGATCAAGAGATGTGGAGGATCCCTCCGCCCGTGTCCAACTGGAAGAACCCC
AAGGGCTTTACCGTTCCTCTGGATAAGCGTCTGGCCGCTGACGGTCGTGGTCTGCACGACGTGACCATCAACGAC
AAGCACGCGCAATTCGCCGAGGCCGTCAAGATGGCCGAACGGCACGCGCGCGAGGTGCAGCAGCGGGCCCTGATG
CAGCAGCGGCTCGCGGAGCAGGAGAAGGCTCGAAAGGATGACAGCCTCCGGGCATTGGCGCTGAAGACGCGCGAA
GAGCGACTCGCTCAGTCATCAACTCCTCGAGCCTCGGAAGAATCTGACAGCGAAGACGCCGAGATCCGCGAACGC
GAAAGGCCCGACGCGAGCGGCGCAAGGAAGAAGAGCGCAAACTGCGGCAGAACAGAATGGGCGCAGAGCGGCGGA
TCCAGGGGCTTCGACAGCGGCTTTAACGAGGACAACCATTACGATAAGCCGCTGTTCGCTGCTCAGGACGCCATC
TCCAGCATCTACCGTCCGCGAGCCAACGTCAATGACGACAGCTTCGACGACGACGCGGGCGACAAGGAGATGGCC
AAGATTCACAAGATTAGCCGCTTCGGCGAGGCTCTCGGCAAGGGACCTTTCGAGGCGCGGCCGATGCCGAGGCAA
ACCGTAGGCACGCGAAGGACCCGTTCAGTTCGAAAGGAGGCAGCCGATCCTTTCAACGTCGACAAATTCCTGTCC
GAGGTGGACCAGAGCACTTCGTCGAAGCGCGGCTACGGCCTCCAGGCGGATGGCGGAGGAGGAGGTCGGCAGGCG
AAACGGGCACGGGTCGACGATGACGATGACGAGGGCGGCGGTGGCGGCGAGTGA
Transcript >Ophcf2|07443
ATGAGACTGCCAACCATCGCAGCGGGCGTCTTTGCCTGTTTAGTCACCAATGTCGTCGCCACGGCGCTGACGTAC
AAGCTGGAAGCGGGCGAGAAGGCCTGCTTCTACGCCGAGACCAACAAGGAGAACGAGAAGATTGCGTTTTATTTT
GCCGTCCAATCTGGAGGCTCTTTCGATATCGACTACCGTGTTGAGGGCCCGGACTCGAAGATTATCCTCGAGGGC
GAGAAGGAGCGTCAAGGCGACTTCGTCTTCTCGGCTCAAAAGACGGGCGAATACTCTTTTTGTTTCGACAACGAG
ATGAGCACCTTTACGGAGAAGATGATCGATATCGAGATCTCAAGCGAGCACGAAGCCCGCACAGCCCAGCTTCCA
TCCAAGCAGGGAACATCTCCCGAGCAAACGTCGGTCCTGGAGGAGTCGATATTCAAGATCTCAGGTCAACTATCT
ACCATCTCGCGCAACCAGAAATACTTTCGAACTCGGGAAAACCGCAACTTTAGCACCGTCAACAGCACAGAGAAA
CGGATTGTCAACTTTAGCGTGATTCAGATTTGCCTTATCGTCTGCATGGGCGCCCTTCAGGTGTTGGTCGTCAGG
TTCTTCTTCCAGGGAGCACGCAAAGGCTATGATCTCATTCCGTTGCGGCAGCGGGCTGACGCTGGCGAGATCGAT
CTCGCCCGGCCAGACAAGGAGACGGTGGCGGCGACGACAGAAAAGACCAAGAACGCCTTGACCGCACTCATCAGC
GGCGCCGTGGCAGCGCAGAAGCCAAAGAATATCAACGTCGGACAGCGAAAGGAAGCCACCTTTGTGCGCTACACG
CCGGCCAACCAAATGGGCGATAATTCCAAGAAGCAGGACCGCATCATCAAGATTGTCGAGCGACAACGCGATCCC
ATGGAGCCGCCCAAGTTCAAGCACAAGAAGATCCCCCGCGGTCCTCCTTCACCGCCGCCGCCTGTGATGCGCTCG
CCGCCCCGGAAGCTTACAGCCGAGGATCAAGAGATGTGGAGGATCCCTCCGCCCGTGTCCAACTGGAAGAACCCC
AAGGGCTTTACCGTTCCTCTGGATAAGCGTCTGGCCGCTGACGGTCGTGGTCTGCACGACGTGACCATCAACGAC
AAGCACGCGCAATTCGCCGAGGCCGTCAAGATGGCCGAACGGCACGCGCGCGAGGTGCAGCAGCGGGCCCTGATG
CAGCAGCGGCTCGCGGAGCAGGAGAAGGCTCGAAAGGATGACAGCCTCCGGGCATTGGCGCTGAAGACGCGCGAA
GAGCGACTCGCTCAGTCATCAACTCCTCGAGCCTCGGAAGAATCTGACAGCGAAGACGCCGAGATCCGCGAACGC
GAAAGGCCCGACGCGAGCGGCGCAAGGAAGAAGAGCGCAAACTGCGGCAGAACAGAATGGGCGCAGAGCGGCGGA
TCCAGGGGCTTCGACAGCGGCTTTAACGAGGACAACCATTACGATAAGCCGCTGTTCGCTGCTCAGGACGCCATC
TCCAGCATCTACCGTCCGCGAGCCAACGTCAATGACGACAGCTTCGACGACGACGCGGGCGACAAGGAGATGGCC
AAGATTCACAAGATTAGCCGCTTCGGCGAGGCTCTCGGCAAGGGACCTTTCGAGGCGCGGCCGATGCCGAGGCAA
ACCGTAGGCACGCGAAGGACCCGTTCAGTTCGAAAGGAGGCAGCCGATCCTTTCAACGTCGACAAATTCCTGTCC
GAGGTGGACCAGAGCACTTCGTCGAAGCGCGGCTACGGCCTCCAGGCGGATGGCGGAGGAGGAGGTCGGCAGGCG
AAACGGGCACGGGTCGACGATGACGATGACGAGGGCGGCGGTGGCGGCGAGTGA
Gene >Ophcf2|07443
ATGAGACTGCCAACCATCGCAGCGGGCGTCTTTGCCTGTTTAGTCACCAATGTCGTCGCCACGGCGCTGACGTAC
AAGCTGGAAGCGGGCGAGAAGGCCTGCTTCTACGCCGAGACCAACAAGGAGAACGAGAAGATTGCGTTTTATTTT
GCCGTAGGCTTTCTTCGCTGAGGCATCTGGGTCTTCTGTGCTTATTCTGACCGCATCATAGGTCCAATCTGGAGG
CTCTTTCGATATCGACTACCGTGTTGAGGGCCCGGACTCGAAGATTATCCTCGAGGGCGAGAAGGAGCGTCAAGG
CGACTTCGTCTTCTCGGCTCAAAAGACGGGCGAATACTCTTTTTGTTTCGACAACGAGATGAGCACCTTTACGGA
GAAGATGATCGATATCGAGATCTCAGTCTGTTCACCCAGCGGCCCTACCGTCATACACAGGCATGCTGATTCTTT
CATGGTGCAGAGCGAGCACGAAGCCCGCACAGCCCAGCTTCCATCCAAGCAGGGAACATCTCCCGAGCAAACGTC
GGTCCTGGAGGAGTCGATATTCAAGATCTCAGGTCAACTATCTACCATCTCGCGCAACCAGAAATACTTTCGAAC
TCGGGAAAACCGCAACTTTAGCACCGTCAACAGCACAGAGAAACGGATTGTCAACTTTAGCGTGATTCAGATTTG
CCTTATCGTCTGCATGGGCGCCCTTCAGGTGTTGGTCGTCAGGTTCTTCTTCCAGGTATGTCCATAAGCCTATGA
TGATCGAGAGTAGTATCTGACAGCCTTTGCCAAACTCAGGGAGCACGCAAAGGCTATGTATGAAGCATTATAAGA
CTGTCTGAATGTGATTCGCGCTGTGTTGTTGGGCGAGGAGCAAAAGCGAGATACGGAAGCGTTACGAGGCGTCAC
AAGTGTTCAGAAGCCGTCGAAGGTACCGGCGAGCCTGCTTCTGAGGTGTTTCATCTACGCTCTCTTGTTCATTGT
GGTGCCCGGAACCTCGTCGGTTTCATGCGGCTTGAGTAGACATTGAAGACGAGGATGCTACATGTAGGTTGGGGG
AAGTCGGCTGATTCCTACATTATTTCGCGTGTTGGTAGACAGAGGCCTGTTGTATTAGGCTATATCTGCAGCCTC
TGAATATGGATAATGTAGCAAATGAACTTTTGAGGACGTTGGCATCGTGGGGACGAAATATCTTGTATTCCATGA
GCACTGAGCAGTGACGACAACCTCTCTCGGCTTGCTAAGGTTGAACGGATGACAAATATGCACCGCCACAGCGGA
CATGACTACGCCACACGTTGAAATTTACTAAGACTCCACCACGGACAGGAGCGGCTTCTTCTCCGTGAACTGGAA
ACTTCAAGTAACGACGAGGCGCCGATCCGCGATGGCCTCGATTGCCGCATCTCCAGGCTTCGCTGCCGCAGCCGA
AATACACGGGAGGAAATGAGGAAGAAGAATCTCGATCGCAGCAGCGCGGCCCGCGTATCGTCAGCGCCAGCCAGC
TGGACGAGAGCCAGGTTGTGCTAAGACGAACGGGACCGCCGCCTTATGGCCAGCGAGAAGGCTGGAGGCCACGGT
CACAGGAGGACTATGGAGATGGAGGCGCGTTTCCCGAGGTTCCGGTGGCTCAGTATCCGCTCGACATGGGCAGGA
AGCACGGAGTCAAGAGCAACGCGTTGGCGATACAGGTCGATTCTGAGGGCAAAGTCAAGTATGACGCCATCGCGA
GACGCGGCCACGGCGACGGCCGGATCATCCACACGTCCTTTAGGATCTCATTCCGTTGCGGCAGCGGGCTGACGC
TGGCGAGATCGATCTCGCCCGGCCAGACAAGGAGACGGTGGCGGCGACGACAGAAAAGACCAAGAACGCCTTGAC
CGCACTCATCAGCGGCGCCGTGGCAGCGCAGAAGCCAAAGAATATCAACGTCGGACAGCGAAAGGAAGCCACCTT
TGTGCGCTACACGCCGGCCAACCAAATGGGCGATAATTCCAAGAAGCAGGACCGCATCATCAAGATTGTCGAGCG
ACAACGCGATCCCATGGAGCCGCCCAAGTTCAAGCACAAGAAGATCCCCCGCGGTCCTCCTTCACCGCCGCCGCC
TGTGATGCGCTCGCCGCCCCGGAAGCTTACAGCCGAGGATCAAGAGATGTGGAGGATCCCTCCGCCCGTGTCCAA
CTGGAAGAACCCCAAGGGCTTTACCGTTCCTCTGGATAAGCGTCTGGCCGCTGACGGTCGTGGTCTGCACGACGT
GACCATCAACGACAAGCACGCGCAATTCGCCGAGGCCGTCAAGATGGCCGAACGGCACGCGCGCGAGGTGCAGCA
GCGGGCCCTGATGCAGCAGCGGCTCGCGGAGCAGGAGAAGGCTCGAAAGGATGACAGCCTCCGGGCATTGGCGCT
GAAGACGCGCGAAGAGCGACTCGCTCAGTCATCAAGTCGCGGAAGAAGAGAGTCGAGGACGTCTGGGTCACGGTC
ACGGTCGCGAAGCCACAGCTCCTCGAGCCTCGGAAGAATCTGACAGCGAAGACGCCGAGATCCGCGAACGCGAAA
GGCCCGACGCGAGCGGCGCAAGGAAGAAGAGCGCAAACTGCGGCAGAACAGAATGGGCGCAGAGCGGCGGATCCA
GGTCATGGCACGAGAGCAGGGACGCGACATCTCGGAGAAGATTGCGCTGGGGCTGGCGAAGCCGACTCAATCAAG
GAGAGCATGTACGACTCGCGTCTCTTCAACCGATCAGGGGCTTCGACAGCGGCTTTAACGAGGACAACCATTACG
ATAAGCCGCTGTTCGCTGCTCAGGACGCCATCTCCAGCATCTACCGTCCGCGAGCCAACGTCAATGACGACAGCT
TCGACGACGACGCGGGCGACAAGGAGATGGCCAAGATTCACAAGATTAGCCGCTTCGGCGAGGCTCTCGGCAAGG
GACCTTTCGAGGCGCGGCCGATGCCGAGGTGAGTTGCTCTTTTCCTTGTCTCTTTTCGTCCCTTGTCCATCTCTT
CAGAGTTCCCTGACAGGCAAACCGTAGGCACGCGAAGGACCCGTTCAGTTCGAAAGGAGGCAGCCGATCCTTTCA
ACGTCGACAAATTCCTGTCCGAGGTGGACCAGAGCACTTCGTCGAAGCGCGGCTACGGCCTCCAGGCGGATGGCG
GAGGAGGAGGTCGGCAGGCGAAACGGGCACGGGTCGACGATGACGATGACGAGGGCGGCGGTGGCGGCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail