Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07438
Gene name
Locationscaffold_11:68822..69449
Strand-
Gene length (bp)627
Transcript length (bp)399
Coding sequence length (bp)399
Protein length (aa) 133

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05724 TPMT Thiopurine S-methyltransferase (TPMT) 4.6E-13 9 76

GO

GO Term Description Terminal node
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0008168 methyltransferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.7434 0.5776 0.0551 0.0407 0.1168 0.0246 0.0396 0.1024 0.2938 0.0368

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup980
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6142
Ophiocordyceps australis map64 (Brazil) OphauB2|5311
Ophiocordyceps camponoti-floridani Ophcf2|02052
Ophiocordyceps camponoti-floridani Ophcf2|07438 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7014
Ophiocordyceps kimflemingae Ophio5|7397
Ophiocordyceps subramaniannii Hirsu2|791

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07438
MRCCSPRTGFDLIFDYTFLCALAPQHRPRWAKRITQLMLPGGRLVCLEYPSWKPMSEPGPPWGVSPELYEALLSA
PGEAPAYGADGSVVADPIAQPRHDALHRLAIIKPTRTHDAGTGPDGSVLDFISVWSR*
Coding >Ophcf2|07438
ATGCGCTGCTGCTCGCCTCGTACGGGCTTTGACCTCATCTTTGACTATACGTTCTTATGCGCCCTCGCGCCACAA
CATCGTCCTCGCTGGGCCAAGCGCATCACCCAGCTCATGTTGCCCGGTGGTCGCCTCGTCTGTCTCGAGTACCCT
TCGTGGAAACCAATGTCGGAGCCCGGCCCGCCATGGGGCGTCAGTCCGGAGCTGTACGAGGCCCTTCTGTCGGCA
CCGGGCGAGGCACCGGCTTACGGCGCAGACGGTTCCGTCGTCGCCGACCCCATCGCCCAGCCCCGTCACGACGCC
CTGCATCGGCTGGCCATCATCAAGCCGACGCGAACCCACGACGCCGGAACCGGGCCTGATGGCTCCGTCCTCGAC
TTCATCTCTGTCTGGTCCCGGTGA
Transcript >Ophcf2|07438
ATGCGCTGCTGCTCGCCTCGTACGGGCTTTGACCTCATCTTTGACTATACGTTCTTATGCGCCCTCGCGCCACAA
CATCGTCCTCGCTGGGCCAAGCGCATCACCCAGCTCATGTTGCCCGGTGGTCGCCTCGTCTGTCTCGAGTACCCT
TCGTGGAAACCAATGTCGGAGCCCGGCCCGCCATGGGGCGTCAGTCCGGAGCTGTACGAGGCCCTTCTGTCGGCA
CCGGGCGAGGCACCGGCTTACGGCGCAGACGGTTCCGTCGTCGCCGACCCCATCGCCCAGCCCCGTCACGACGCC
CTGCATCGGCTGGCCATCATCAAGCCGACGCGAACCCACGACGCCGGAACCGGGCCTGATGGCTCCGTCCTCGAC
TTCATCTCTGTCTGGTCCCGGTGA
Gene >Ophcf2|07438
ATGCGCTGCTGCTCGCCTCGTACGGGTACGATGTTTGGGCGCTGGATGAGAGGGATGGGGCGTGGGAGGAGGACG
AGGAGGAGGACGAGGTTGCATGCTTGTATCCGGCTGTGCGGGAACATGTTGGATGCGGCGCCGTTACTTGGCTTG
TCGCCGACTTCCTGGCTGACGAGTGGTCGCACGGCCTAGGCTTTGACCTCATCTTTGACTATACGGTTGCTTCCC
CCTTTCCGGCATTTTGCTTGATATCCCTTTTCATCTGACGAGACGGATCGGTAGTTCTTATGCGCCCTCGCGCCA
CAACATCGTCCTCGCTGGGCCAAGCGCATCACCCAGCTCATGTTGCCCGGTGGTCGCCTCGTCTGTCTCGAGTAC
CCTTCGTGGAAACCAATGTCGGAGCCCGGCCCGCCATGGGGCGTCAGTCCGGAGCTGTACGAGGCCCTTCTGTCG
GCACCGGGCGAGGCACCGGCTTACGGCGCAGACGGTTCCGTCGTCGCCGACCCCATCGCCCAGCCCCGTCACGAC
GCCCTGCATCGGCTGGCCATCATCAAGCCGACGCGAACCCACGACGCCGGAACCGGGCCTGATGGCTCCGTCCTC
GACTTCATCTCTGTCTGGTCCCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail