Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07432
Gene name
Locationscaffold_11:53617..54606
Strand+
Gene length (bp)989
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09463 Opy2 Opy2 protein 1.6E-06 31 67

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Signal peptide 0.1664 0.0954 0.3598 0.7096 0.1282 0.0216 0.1006 0.5319 0.2084 0.0382

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 92 114 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.47 0.0 1.09
Alive In ants, during behavior modification 0.76 0.0 1.68
Dead In ants, recently dead 0.88 0.0 1.91

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.410523 no
Alive Dead 0.792028 no
Dead Fungus 0.288049 no

Orthologs

Orthofinder run ID4
Orthogroup1003
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4848
Ophiocordyceps australis map64 (Brazil) OphauB2|5304
Ophiocordyceps camponoti-floridani Ophcf2|02058
Ophiocordyceps camponoti-floridani Ophcf2|07432 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1029
Ophiocordyceps kimflemingae Ophio5|7406
Ophiocordyceps subramaniannii Hirsu2|8598

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07432
MMRAASPYPITLRDVDALRTVLEHAPQKRECAKCEEASKLQCPACPQGQVCQYTVPTDCTQCAQMVCMVDDSPQS
SNNAASSGSGGSSGPSAAPIAGGVIGGVAVIATLTYLVWRFLIIPKRSRVPETIYSAKTPRDAEKDNASRFTHRS
STHTVHSIASTVLTRASNIIQIAYIPGVTNRATPTSPSVLVPPVPPIPMQHQQGSPSSTQDDQRFFVPGNLRDST
YSGISDYTDRTSYAPRSSIASTIYGRQAQVQSPAQTGMRAKPTVVSVRPGGATAAAAASNAPPCQASTSRGSVAP
ALAPRAWPAP*
Coding >Ophcf2|07432
ATGATGCGGGCAGCATCGCCATATCCCATCACCTTGCGGGACGTTGACGCTCTGCGGACAGTTTTGGAACATGCG
CCGCAGAAACGCGAATGTGCCAAATGCGAAGAGGCGTCCAAGCTTCAATGCCCCGCGTGTCCCCAGGGCCAGGTC
TGCCAATATACGGTTCCTACCGATTGCACTCAGTGCGCCCAGATGGTGTGCATGGTCGACGACTCTCCACAGTCT
TCCAATAACGCGGCCAGCAGCGGAAGCGGAGGCAGCAGCGGACCCAGCGCCGCGCCTATCGCGGGAGGCGTCATT
GGAGGCGTCGCCGTCATCGCAACCCTCACATATCTCGTCTGGAGGTTCCTTATCATTCCCAAGCGATCACGCGTT
CCCGAAACAATCTACAGCGCCAAGACGCCACGAGATGCCGAAAAGGACAACGCGTCCCGGTTCACGCACCGGTCA
TCGACACATACGGTTCACTCCATCGCATCGACGGTGCTGACACGTGCCTCCAACATCATCCAAATAGCCTACATC
CCTGGCGTCACTAACCGAGCAACGCCCACTTCGCCCTCGGTCCTCGTGCCACCCGTACCGCCCATCCCGATGCAG
CACCAGCAAGGCAGCCCCAGCTCGACTCAGGATGATCAGCGCTTCTTCGTGCCCGGTAACCTGCGCGACTCGACC
TACTCGGGCATCTCCGACTACACGGACCGCACCTCGTACGCCCCTCGCTCCAGTATCGCATCTACCATCTACGGC
AGACAGGCCCAGGTGCAATCGCCGGCTCAGACGGGCATGCGGGCCAAGCCGACCGTCGTCAGCGTCAGGCCAGGT
GGCGCCACAGCCGCAGCCGCCGCCTCCAACGCGCCCCCATGCCAAGCATCGACTTCGAGAGGTTCGGTGGCGCCG
GCGCTCGCCCCAAGAGCGTGGCCAGCACCCTGA
Transcript >Ophcf2|07432
ATGATGCGGGCAGCATCGCCATATCCCATCACCTTGCGGGACGTTGACGCTCTGCGGACAGTTTTGGAACATGCG
CCGCAGAAACGCGAATGTGCCAAATGCGAAGAGGCGTCCAAGCTTCAATGCCCCGCGTGTCCCCAGGGCCAGGTC
TGCCAATATACGGTTCCTACCGATTGCACTCAGTGCGCCCAGATGGTGTGCATGGTCGACGACTCTCCACAGTCT
TCCAATAACGCGGCCAGCAGCGGAAGCGGAGGCAGCAGCGGACCCAGCGCCGCGCCTATCGCGGGAGGCGTCATT
GGAGGCGTCGCCGTCATCGCAACCCTCACATATCTCGTCTGGAGGTTCCTTATCATTCCCAAGCGATCACGCGTT
CCCGAAACAATCTACAGCGCCAAGACGCCACGAGATGCCGAAAAGGACAACGCGTCCCGGTTCACGCACCGGTCA
TCGACACATACGGTTCACTCCATCGCATCGACGGTGCTGACACGTGCCTCCAACATCATCCAAATAGCCTACATC
CCTGGCGTCACTAACCGAGCAACGCCCACTTCGCCCTCGGTCCTCGTGCCACCCGTACCGCCCATCCCGATGCAG
CACCAGCAAGGCAGCCCCAGCTCGACTCAGGATGATCAGCGCTTCTTCGTGCCCGGTAACCTGCGCGACTCGACC
TACTCGGGCATCTCCGACTACACGGACCGCACCTCGTACGCCCCTCGCTCCAGTATCGCATCTACCATCTACGGC
AGACAGGCCCAGGTGCAATCGCCGGCTCAGACGGGCATGCGGGCCAAGCCGACCGTCGTCAGCGTCAGGCCAGGT
GGCGCCACAGCCGCAGCCGCCGCCTCCAACGCGCCCCCATGCCAAGCATCGACTTCGAGAGGTTCGGTGGCGCCG
GCGCTCGCCCCAAGAGCGTGGCCAGCACCCTGA
Gene >Ophcf2|07432
ATGATGCGGGCAGCATCGCCATATCCCATCACCTTGCGGGACGTTGACGCTCTGCGGACAGGTGCGTGGCATGAT
GCTAGCTAGCCTCCCCCTTCGACTGACGCCTCGCCTTCTCAGTTTTGGAACATGCGCCGCAGAAACGCGAATGTG
CCAAATGCGAAGAGGCGTCCAAGCTTCAATGCCCCGCGTGTCCCCAGGGCCAGGTCTGCCAATATACGGTTCCTA
CCGATTGCACTCAGTGCGCCCAGATGGTGTGCATGGTCGACGACTCTCCACAGTCTTCCAATAACGCGGCCAGCA
GCGGAAGCGGAGGCAGCAGCGGACCCAGCGCCGCGCCTATCGCGGGAGGCGTCATTGGAGGCGTCGCCGTCATCG
CAACCCTCACATATCTCGTCTGGAGGTTCCTTATCATTCCCAAGCGATCACGCGTTCCCGAAACAATCTACAGCG
CCAAGACGCCACGAGATGCCGAAAAGGACAACGCGTCCCGGTTCACGCACCGGTCATCGACACATACGGTTCACT
CCATCGCATCGACGGTGCTGACACGTGCCTCCAACATCATCCAAATAGCCTACATCCCTGGCGTCACTAACCGAG
CAACGCCCACTTCGCCCTCGGTCCTCGTGCCACCCGTACCGCCCATCCCGATGCAGCACCAGCAAGGCAGCCCCA
GCTCGACTCAGGATGATCAGCGCTTCTTCGTGCCCGGTAACCTGCGCGACTCGACCTACTCGGGCATCTCCGACT
ACACGGACCGCACCTCGTACGCCCCTCGCTCCAGTATCGCATCTACCATCTACGGCAGACAGGCCCAGGTGCAAT
CGCCGGCTCAGACGGGCATGCGGGCCAAGCCGACCGTCGTCAGCGTCAGGCCAGGTGGCGCCACAGCCGCAGCCG
CCGCCTCCAACGCGCCCCCATGCCAAGCATCGACTTCGAGAGGTTCGGTGGCGCCGGCGCTCGCCCCAAGAGCGT
GGCCAGCACCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail