Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07429
Gene name
Locationscaffold_11:44764..46222
Strand-
Gene length (bp)1458
Transcript length (bp)1230
Coding sequence length (bp)1230
Protein length (aa) 410

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain 6.3E-45 82 246
PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain 6.4E-40 254 398

GO

GO Term Description Terminal node
GO:0004455 ketol-acid reductoisomerase activity Yes
GO:0009082 branched-chain amino acid biosynthetic process Yes
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0009987 cellular process No
GO:0019752 carboxylic acid metabolic process No
GO:0009081 branched-chain amino acid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0016491 oxidoreductase activity No
GO:1901576 organic substance biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1056 0.071 0.0424 0.0703 0.926 0.1719 0.0395 0.0597 0.1006 0.0375

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup901
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|360
Ophiocordyceps australis map64 (Brazil) OphauB2|5323
Ophiocordyceps camponoti-floridani Ophcf2|02061
Ophiocordyceps camponoti-floridani Ophcf2|07429 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1031
Ophiocordyceps kimflemingae Ophio5|7872
Ophiocordyceps subramaniannii Hirsu2|5887

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07429
MASRSLSRALRVPAARQLASPRLVRPFSSLVAGRGLLRASATTAIRPTVQTRGKKTINFAGVREDVWERSDWSVE
RLLEYFRGDTLALIGYGSQGHGQGLNLRDNGLNVIVGVRPGGKSWNDAIQDGWKPGKNLMSIKDAISKGNIIMNL
LSDAAQSETWPVIKPQLTKEKTLYFSHGFSPVFKDLTKVDVPKNIDVILVAPKGSGRTVRSLFREGRGINSSYAV
YQDVSGIAEEKAIALGVAIGSGYLYKTTFQKEVYSDLYGERGCLMGGIHGMFLAQYEVLRQRGHSPSEAFNETVE
EATQSLYPLIGANGMDWMFEACSTTARRGAIDWTPKFKKALLPVFNELYDSVVDGTETKRSLEYNSQKDYREQYE
QEMQDIKNMEIWQAGQAVRSLRPENQGQHTEEDD*
Coding >Ophcf2|07429
ATGGCGTCGAGAAGTCTCTCCAGGGCGCTGCGTGTGCCAGCAGCCCGCCAATTGGCCTCGCCTCGCCTCGTCCGG
CCCTTTTCCAGCCTCGTGGCCGGTCGCGGCCTGTTACGGGCCTCTGCCACGACTGCCATCCGACCGACGGTGCAG
ACGCGTGGAAAGAAGACGATTAACTTTGCGGGCGTCAGGGAGGATGTTTGGGAGCGTTCTGACTGGTCCGTGGAG
AGGCTCCTGGAATACTTTAGGGGTGACACGCTGGCCCTCATCGGCTACGGCTCTCAGGGCCACGGCCAGGGCCTT
AACCTCCGCGACAACGGCCTCAACGTCATCGTCGGCGTTCGCCCCGGTGGCAAGTCGTGGAATGACGCTATACAG
GACGGCTGGAAGCCCGGAAAGAACCTGATGAGTATCAAGGATGCCATCTCCAAGGGCAACATCATCATGAACCTG
CTCAGCGACGCCGCCCAGTCGGAGACGTGGCCGGTCATCAAGCCGCAGCTCACCAAGGAAAAGACGCTGTACTTT
TCTCACGGCTTCTCACCCGTCTTCAAGGACCTGACCAAGGTCGACGTGCCCAAGAACATTGACGTCATTCTCGTC
GCGCCCAAGGGCTCCGGACGGACTGTTCGTTCCCTCTTCCGCGAGGGTCGTGGCATCAACTCGTCCTATGCCGTC
TACCAGGACGTGAGTGGCATAGCCGAGGAGAAGGCCATCGCGCTGGGCGTTGCCATCGGATCTGGCTACCTGTAC
AAGACGACCTTCCAGAAGGAAGTCTACTCGGACCTGTACGGCGAGCGCGGCTGCTTGATGGGCGGCATCCACGGC
ATGTTCCTGGCCCAGTACGAGGTCCTCCGTCAGCGCGGCCACAGCCCGAGCGAGGCCTTTAACGAGACGGTCGAG
GAGGCGACGCAGAGCCTTTACCCCCTCATCGGGGCCAACGGCATGGATTGGATGTTTGAGGCCTGCTCGACGACG
GCCCGACGCGGCGCCATCGACTGGACGCCCAAGTTCAAGAAGGCTCTGTTGCCCGTCTTCAATGAGTTGTACGAC
AGCGTCGTAGACGGCACCGAGACGAAGCGGTCGCTCGAGTACAACAGCCAAAAGGACTACCGCGAGCAGTATGAA
CAGGAGATGCAGGATATCAAAAATATGGAGATCTGGCAGGCCGGTCAAGCCGTGCGATCGTTGCGACCTGAGAAC
CAGGGCCAGCATACTGAGGAAGATGACTGA
Transcript >Ophcf2|07429
ATGGCGTCGAGAAGTCTCTCCAGGGCGCTGCGTGTGCCAGCAGCCCGCCAATTGGCCTCGCCTCGCCTCGTCCGG
CCCTTTTCCAGCCTCGTGGCCGGTCGCGGCCTGTTACGGGCCTCTGCCACGACTGCCATCCGACCGACGGTGCAG
ACGCGTGGAAAGAAGACGATTAACTTTGCGGGCGTCAGGGAGGATGTTTGGGAGCGTTCTGACTGGTCCGTGGAG
AGGCTCCTGGAATACTTTAGGGGTGACACGCTGGCCCTCATCGGCTACGGCTCTCAGGGCCACGGCCAGGGCCTT
AACCTCCGCGACAACGGCCTCAACGTCATCGTCGGCGTTCGCCCCGGTGGCAAGTCGTGGAATGACGCTATACAG
GACGGCTGGAAGCCCGGAAAGAACCTGATGAGTATCAAGGATGCCATCTCCAAGGGCAACATCATCATGAACCTG
CTCAGCGACGCCGCCCAGTCGGAGACGTGGCCGGTCATCAAGCCGCAGCTCACCAAGGAAAAGACGCTGTACTTT
TCTCACGGCTTCTCACCCGTCTTCAAGGACCTGACCAAGGTCGACGTGCCCAAGAACATTGACGTCATTCTCGTC
GCGCCCAAGGGCTCCGGACGGACTGTTCGTTCCCTCTTCCGCGAGGGTCGTGGCATCAACTCGTCCTATGCCGTC
TACCAGGACGTGAGTGGCATAGCCGAGGAGAAGGCCATCGCGCTGGGCGTTGCCATCGGATCTGGCTACCTGTAC
AAGACGACCTTCCAGAAGGAAGTCTACTCGGACCTGTACGGCGAGCGCGGCTGCTTGATGGGCGGCATCCACGGC
ATGTTCCTGGCCCAGTACGAGGTCCTCCGTCAGCGCGGCCACAGCCCGAGCGAGGCCTTTAACGAGACGGTCGAG
GAGGCGACGCAGAGCCTTTACCCCCTCATCGGGGCCAACGGCATGGATTGGATGTTTGAGGCCTGCTCGACGACG
GCCCGACGCGGCGCCATCGACTGGACGCCCAAGTTCAAGAAGGCTCTGTTGCCCGTCTTCAATGAGTTGTACGAC
AGCGTCGTAGACGGCACCGAGACGAAGCGGTCGCTCGAGTACAACAGCCAAAAGGACTACCGCGAGCAGTATGAA
CAGGAGATGCAGGATATCAAAAATATGGAGATCTGGCAGGCCGGTCAAGCCGTGCGATCGTTGCGACCTGAGAAC
CAGGGCCAGCATACTGAGGAAGATGACTGA
Gene >Ophcf2|07429
ATGGCGTCGAGAAGTCTCTCCAGGGCGCTGCGTGTGCCAGCAGCCCGCCAATTGGCCTCGCCTCGCCTCGTCCGG
CCCTTTTCCAGCCTCGTGGCCGGTCGCGGCCTGTTACGGGCCTCTGCCACGACTGCCATCCGACCGACGGTGCAG
ACGCGTGGAAAGAAGACGATTAACTTTGCGGGCGTCAGGGAGGATGTTTGGGGTATGGGACTGTCCCTTTCGGGG
TGTTGGTTGGGCTTGGCTGACTTTGCTTGTGTAGAGCGTTCTGACTGGTCCGTGGAGAGGCTCCTGGTGAGTTGC
GACGCCTCTCTTTTTTATTATTTCCCGGCTGTTCTGACGTGGAACCTGCAGGAATACTTTAGGGGTGACACGCTG
GCCCTCATCGGCTACGGCTCTCAGGGCCACGGCCAGGGCCTTAACCTCCGCGACAACGGCCTCAACGTCATCGTC
GGCGTTCGCCCCGGTGGCAAGTCGTGGAATGACGCTATACAGGACGGCTGGAAGCCCGGAAAGAACCTGATGAGT
ATCAAGGATGCCATCTCCAAGGGCAACATCATCATGAACCTGCTCAGCGACGCCGCCCAGTCGGAGACGTGGCCG
GTCATCAAGCCGCAGCTCACCAAGGAAAAGGTGAGCGTCTACTCCTCGTTATCGAGTCTGAGATGGTGACGCTGA
CGACAACAGACGCTGTACTTTTCTCACGGCTTCTCACCCGTCTTCAAGGACCTGACCAAGGTCGACGTGCCCAAG
AACATTGACGTCATTCTCGTCGCGCCCAAGGGCTCCGGACGGACTGTTCGTTCCCTCTTCCGCGAGGGTCGTGGC
ATCAACTCGTCCTATGCCGTCTACCAGGACGTGAGTGGCATAGCCGAGGAGAAGGCCATCGCGCTGGGCGTTGCC
ATCGGATCTGGCTACCTGTACAAGACGACCTTCCAGAAGGAAGTCTACTCGGACCTGTACGGCGAGCGCGGCTGC
TTGATGGGCGGCATCCACGGCATGTTCCTGGCCCAGTACGAGGTCCTCCGTCAGCGCGGCCACAGCCCGAGCGAG
GCCTTTAACGAGACGGTCGAGGAGGCGACGCAGAGCCTTTACCCCCTCATCGGGGCCAACGGCATGGATTGGATG
TTTGAGGCCTGCTCGACGACGGCCCGACGCGGCGCCATCGACTGGACGCCCAAGTTCAAGAAGGCTCTGTTGCCC
GTCTTCAATGAGTTGTACGACAGCGTCGTAGACGGCACCGAGACGAAGCGGTCGCTCGAGTACAACAGCCAAAAG
GACTACCGCGAGCAGTATGAACAGGAGATGCAGGATATCAAAAATATGGAGATCTGGCAGGCCGGTCAAGCCGTG
CGGTACGTGTGACCCGACGAAAGCCGGAACATGGCGTTGGGCTGACTCTTTGGGCACAGATCGTTGCGACCTGAG
AACCAGGGCCAGCATACTGAGGAAGATGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail